KEGG   Rhodopseudomonas palustris BisB5: RPD_2782Help
Entry
RPD_2782          CDS       T00345                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpd  Rhodopseudomonas palustris BisB5
Brite
Enzymes [BR:rpd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPD_2782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 RrnaAD Ubie_methyltran CMAS Methyltransf_23 GCD14 Methyltr_RsmB-F Methyltransf_4 DUF938 Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: ABE40010
JGI: RPD2782
UniProt: Q136H9
Position
complement(3101031..3101684)
Genome map
AA seq 217 aa AA seqDB search
MVSSVAPPPEKMMFQLSLRRRGISDRAVLQAMEAVPRDRFVDPVHRDGAWRDTALPIACG
QTISQPFVVAYMTEQLRLEAGHRLLEIGTGSGYHAAVLSRLVRDVVSVERFKTLADRARA
RLKELNYANVEVLLGDGFAIPEGAGTFDRIIVTAAMTELSQPLLDLLDPGGILIAPIGPA
NGRQTLIRVERKDDDFIRKALVDVRFVPALTGIAREL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggttagttccgtggcgccgccccctgaaaaaatgatgttccagttgagcttgcggcgt
cgcggcatcagcgatcgcgccgtgctgcaggccatggaggcggtgccgcgcgaccgcttc
gtcgacccggtccaccgcgacggcgcgtggcgcgacaccgcgctgccgattgcctgcggc
cagaccatcagccagcccttcgtcgtcgcctacatgaccgagcagcttcgcctcgaggcc
ggtcatcgcctgctcgagatcggcaccggatccggctaccacgccgcggtgctgtcgcgt
ctggtgcgcgatgtcgtcagcgtcgagcgcttcaagacgctcgccgatcgcgcccgcgcc
cgtctgaaggaattgaactacgccaatgtcgaggtgctgctcggcgacggcttcgcgatt
ccggagggagcagggacgttcgaccgcatcatcgtcacggcggcgatgacagaactgtcg
cagccgctgctcgatctgctcgaccccggcggcatcctgatcgcgccgatcggaccggcg
aatgggaggcagacgctgatccgggtcgagcgcaaggacgacgattttatccgcaaggcg
ctggtcgacgtccgcttcgtgccggcgctgaccgggatcgcgcgcgagctctga

DBGET integrated database retrieval system