KEGG   Rhodopseudomonas palustris BisB5: RPD_2829Help
Entry
RPD_2829          CDS       T00345                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPD_2829 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPD_2829 (trpC)
Enzymes [BR:rpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RPD_2829 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3151970..3152767
Genome map
AA seq 265 aa AA seqDB search
MSDILNKIEAYKREEIAAAKRERPLAALQAAARAAPPPRGFVSALRAKLADGDYALIAEI
KKASPSKGLIRPDFDPPALAKAYQQGGAACLSVLTDTPSFQGHLDYLVAARAAVSLPALR
KDFMYDTYQVVEARAHGADCILIIMAALDDSEARDIEDAALDLGMDVLLEVHNHAELDRA
LALRSPMIGVNNRNLRTFEVTLATSEALAPLIPSDRLMVGESGIFTPDDLARLARVGMST
FLVGESLMRQQDVAAATRTLLARAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggacatcctgaacaagatcgaggcctacaagcgcgaggagatcgccgccgccaag
cgcgagcgtccgctcgcagcgttgcaggccgccgcgcgtgcagcgccgccgccgcgcggc
ttcgtcagcgcattgcgcgccaaactcgccgatggcgactacgcgctgatcgccgagatc
aagaaggcgtcgccgtcgaaggggctgatccgccccgatttcgatccgccggcgttggcg
aaagcctaccagcaaggcggcgcggcgtgtctgtcggtgctgaccgatacgccgtcgttc
cagggccacctcgattatctggtcgcggcgcgcgcggcggtgtcgctgccggcgctgcgc
aaggacttcatgtacgacacctatcaggtggtcgaagcccgcgcccatggcgccgattgc
atcctgatcatcatggccgcgctcgatgattccgaggccagggacatcgaggacgccgcg
ctggatctcggcatggacgtgctgctcgaagtccataaccatgccgaactcgaccgcgcg
ctcgcgctgcgctcccccatgatcggggtcaacaatcgcaatctgcgcaccttcgaggtc
acgctcgcgaccagcgaggcgctggcgccgctgatcccctcggatcggctgatggtcggc
gagagcggcatcttcacgcccgacgatctggcgcggctggcacgggtcgggatgtcgacc
ttcctggtcggcgaaagcctgatgcgccagcaggacgtcgccgccgccacccgcacgctg
ctcgcccgcgcagcctga

DBGET integrated database retrieval system