KEGG   Rhodopseudomonas palustris BisB5: RPD_3103Help
Entry
RPD_3103          CDS       T00345                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00010  Glycolysis / Gluconeogenesis
rpd00620  Pyruvate metabolism
rpd00640  Propanoate metabolism
rpd00680  Methane metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_3103
   00620 Pyruvate metabolism
    RPD_3103
   00640 Propanoate metabolism
    RPD_3103
  Energy metabolism
   00680 Methane metabolism
    RPD_3103
Enzymes [BR:rpd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RPD_3103
Lipid biosynthesis proteins [BR:rpd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RPD_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABE40329
JGI: RPD3103
UniProt: Q135B0
Position
3447856..3449544
Genome map
AA seq 562 aa AA seqDB search
MSNTPRPAAAPEDYADVLARFRRDDLEALFDGNFATGLNVCVECCDRHVEGGGIALDWES
QDGRTASFTFAEMKDYAARVANLLVAQGVKPGDVVAGMLPRTPELLALILGTWRAGAVYQ
PLFTAFGPKAIEHRLKMSAAKLVVTDLANRAKLADVVDCPTVAIVTRPGESAPLGDLDFH
AEIASKSTQFEPVLRKGSDLFLMMSTSGTTGLPKGVPVPIDALPAFYSYMRDAVDLRPDD
IFWNIADPGWAYGLYYAVTGPLLLGHATTFFDGPFTAESTYGLIKRRGITNLAGAPTAYR
LLIAAGPAMAAPVKGQLRVVSSAGEPLNPEVIRWFAEHLGAPIHDHYGQTELGMVVNNHH
RLRHTVHPGSAGLAMPGFRVAVLDDDSRELPANVPGILSVDLARSPLMWFSGYWQQDTPA
IANGYYRTGDTVEMEPDGSISFVGRSDDVITSSGYRIGPFDVESALIEHPAVIEAAVIGK
PDAERTEIVKAYVVLANDVEPTDQLAEELRQYVKKRLSAHAYPREIEFLEQLPKTPSGKL
QRFILRKRDVDQSKDAPAPSAH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacactcctcgtccggccgccgcccccgaagattatgccgacgtccttgcgcgg
tttcgccgcgacgacctcgaggccctattcgacggcaatttcgcaaccggcctcaacgtc
tgcgtcgaatgctgcgatcgccacgtcgaaggcggcggcattgcgctcgattgggaaagc
caggacggccgcaccgcctccttcactttcgccgagatgaaggactatgccgcccgcgtc
gccaacctgctggtggcgcagggcgtcaaacccggcgacgtggtcgccggcatgttgccg
cggacgcccgaattacttgccttgatcctcggcacctggcgcgccggcgccgtctatcag
ccgctgttcaccgccttcggacccaaggcgatcgagcaccgcctcaaaatgagcgccgcc
aagctggtggtcaccgacctcgccaaccgggccaagctggccgacgtcgtcgactgcccg
accgtcgcgatcgtcacgcgcccaggtgaaagcgccccgctcggcgacctcgatttccac
gccgagatcgcttcgaaatccacacagttcgagccggtgctgcgcaaaggcagtgacctg
ttcctgatgatgtcgacgtcgggcaccaccggccttcccaagggcgtgccggtgccgatc
gacgcgctgccggcgttctattcctacatgcgcgacgcggtcgacctgcgcccggacgac
atcttctggaacattgccgatcccggctgggcctacgggctgtactacgccgtcaccggt
cccttgctgctcggccacgcgaccacctttttcgacgggccgttcacggccgagagcacc
tacggcctgatcaagcgccgcggcatcaccaatctcgccggcgcccccaccgcctaccga
ctgctgattgcggcgggtccggcgatggcagctccggtgaagggccagcttcgcgtcgtc
agcagcgccggcgagccgctgaacccggaagtgattcgctggttcgccgaacatctcggc
gcgccgatccacgatcattacggccagaccgagctcggcatggtggtcaacaatcaccat
cgcctgcgccataccgtgcatccaggctcggcgggtcttgccatgcccggcttccgcgtc
gcggtgctcgacgacgacagtcgcgaactgccggctaacgtgccgggcattctcagcgtc
gatctcgcccgctcgccgctgatgtggttctctggctattggcagcaggacactcccgcc
atcgccaacggctattaccgcaccggcgacaccgtggagatggaacccgatggctcgatc
agtttcgtcggccgctccgacgacgtcatcacttcgtcgggctaccggatcggtccattc
gacgtcgaaagcgcgctgatcgaacacccggcggtgatcgaggcggcggtgatcggtaag
cctgacgccgagcgcaccgaaatcgtcaaagcctatgtggtactggccaatgacgtcgaa
cccaccgaccaacttgccgaggagctgcgccaatacgtcaagaagcggctctccgcccac
gcctatccgcgcgagatcgaattcctggagcagttgccgaagacaccgagcggcaaactg
cagcggttcattttgcgcaagcgcgatgtcgaccagagcaaggatgcgccggccccgtcg
gcgcactga

DBGET integrated database retrieval system