KEGG   Rhodopseudomonas palustris BisB5: RPD_3103Help
Entry
RPD_3103          CDS       T00345                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rpd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rpd00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3447856..3449544
Genome map
AA seq 562 aa AA seqDB search
MSNTPRPAAAPEDYADVLARFRRDDLEALFDGNFATGLNVCVECCDRHVEGGGIALDWES
QDGRTASFTFAEMKDYAARVANLLVAQGVKPGDVVAGMLPRTPELLALILGTWRAGAVYQ
PLFTAFGPKAIEHRLKMSAAKLVVTDLANRAKLADVVDCPTVAIVTRPGESAPLGDLDFH
AEIASKSTQFEPVLRKGSDLFLMMSTSGTTGLPKGVPVPIDALPAFYSYMRDAVDLRPDD
IFWNIADPGWAYGLYYAVTGPLLLGHATTFFDGPFTAESTYGLIKRRGITNLAGAPTAYR
LLIAAGPAMAAPVKGQLRVVSSAGEPLNPEVIRWFAEHLGAPIHDHYGQTELGMVVNNHH
RLRHTVHPGSAGLAMPGFRVAVLDDDSRELPANVPGILSVDLARSPLMWFSGYWQQDTPA
IANGYYRTGDTVEMEPDGSISFVGRSDDVITSSGYRIGPFDVESALIEHPAVIEAAVIGK
PDAERTEIVKAYVVLANDVEPTDQLAEELRQYVKKRLSAHAYPREIEFLEQLPKTPSGKL
QRFILRKRDVDQSKDAPAPSAH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacactcctcgtccggccgccgcccccgaagattatgccgacgtccttgcgcgg
tttcgccgcgacgacctcgaggccctattcgacggcaatttcgcaaccggcctcaacgtc
tgcgtcgaatgctgcgatcgccacgtcgaaggcggcggcattgcgctcgattgggaaagc
caggacggccgcaccgcctccttcactttcgccgagatgaaggactatgccgcccgcgtc
gccaacctgctggtggcgcagggcgtcaaacccggcgacgtggtcgccggcatgttgccg
cggacgcccgaattacttgccttgatcctcggcacctggcgcgccggcgccgtctatcag
ccgctgttcaccgccttcggacccaaggcgatcgagcaccgcctcaaaatgagcgccgcc
aagctggtggtcaccgacctcgccaaccgggccaagctggccgacgtcgtcgactgcccg
accgtcgcgatcgtcacgcgcccaggtgaaagcgccccgctcggcgacctcgatttccac
gccgagatcgcttcgaaatccacacagttcgagccggtgctgcgcaaaggcagtgacctg
ttcctgatgatgtcgacgtcgggcaccaccggccttcccaagggcgtgccggtgccgatc
gacgcgctgccggcgttctattcctacatgcgcgacgcggtcgacctgcgcccggacgac
atcttctggaacattgccgatcccggctgggcctacgggctgtactacgccgtcaccggt
cccttgctgctcggccacgcgaccacctttttcgacgggccgttcacggccgagagcacc
tacggcctgatcaagcgccgcggcatcaccaatctcgccggcgcccccaccgcctaccga
ctgctgattgcggcgggtccggcgatggcagctccggtgaagggccagcttcgcgtcgtc
agcagcgccggcgagccgctgaacccggaagtgattcgctggttcgccgaacatctcggc
gcgccgatccacgatcattacggccagaccgagctcggcatggtggtcaacaatcaccat
cgcctgcgccataccgtgcatccaggctcggcgggtcttgccatgcccggcttccgcgtc
gcggtgctcgacgacgacagtcgcgaactgccggctaacgtgccgggcattctcagcgtc
gatctcgcccgctcgccgctgatgtggttctctggctattggcagcaggacactcccgcc
atcgccaacggctattaccgcaccggcgacaccgtggagatggaacccgatggctcgatc
agtttcgtcggccgctccgacgacgtcatcacttcgtcgggctaccggatcggtccattc
gacgtcgaaagcgcgctgatcgaacacccggcggtgatcgaggcggcggtgatcggtaag
cctgacgccgagcgcaccgaaatcgtcaaagcctatgtggtactggccaatgacgtcgaa
cccaccgaccaacttgccgaggagctgcgccaatacgtcaagaagcggctctccgcccac
gcctatccgcgcgagatcgaattcctggagcagttgccgaagacaccgagcggcaaactg
cagcggttcattttgcgcaagcgcgatgtcgaccagagcaaggatgcgccggccccgtcg
gcgcactga

DBGET integrated database retrieval system