KEGG   Rhodopseudomonas palustris BisB5: RPD_3399Help
Entry
RPD_3399          CDS       T00345                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rpd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rpd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3777717..3779189)
Genome map
AA seq 490 aa AA seqDB search
MKLRDLFSDDAPIDAQGSPRGAADLDVGGLAVDSRAVKPGDLFFALAGAKTDGARFIAAA
IAAGAVAVAGDHAPDGELAVPFVPLGNPRRALALAAARFYSRQPRTIAAVTGTSGKTSVA
AFTRHIWQRLGHAAASIGTIGLVTPTRSVYGSLTTPDPIALHRSLDEIAGEGVTHLALEA
SSHGLDQFRLDGVRVAAGGFTNLSRDHMDYHPDVAHYLNAKLRLFRDLVIDGGAAVISAD
HDCSAQVIDAARARGLRLITVGRNGDAGEGIRLIEASIDGFAQKLTIEHAGRRTAVHLPL
VGEFQIENALVAAGLVIGAGGDPAAAFAALDHLEGAPGRLDFVGERRGAPVFVDYAHKPD
ALAKALQALRPYAKRKLVVVFGAGGDRDAGKRPLMGAIAAGNADSIIVTDDNPRSEDPAA
IRAAILAAAPGAREIGDRAEAIRTAIAALAPGDALLIAGKGHETGQIVRDTVLPFSDHEA
AAAALSTSAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccgcgatctcttcagcgacgacgccccgatcgacgcacagggctcgccgcgc
ggcgccgccgatctcgatgtcggcggccttgcggtcgacagccgcgcggtgaagccgggc
gatctgttctttgcgctggccggggcgaagaccgacggcgcacgcttcatcgccgctgcg
atcgccgccggcgcggtcgcggtcgccggcgatcatgcgccggatggcgaactcgccgtg
ccgttcgtgcccctcggcaatccgcgccgcgcgctggcgctggccgccgcgcgattctat
tcgcgacagccgcgaaccatcgccgcggtgaccgggaccagcggcaagacctcggtcgcg
gcgttcacccggcatatctggcaacggctcggacacgctgcggcaagcatcggcaccatc
ggcctggtcaccccgacgcgcagcgtctacggttcactgacaacgccggacccgatcgcg
ctgcatcgctcgctcgacgagatcgccggcgaaggcgtcacgcatctggcgctcgaagcc
tcatcgcacgggctcgatcagttccggctcgacggcgttcgcgtcgcggccggcggcttc
accaatctgtcgcgcgaccatatggactaccatccggacgtcgcgcactacctcaacgcc
aagctccggctgtttcgcgatctggtgatcgacggcggggccgcggtgatttccgctgac
cacgactgttcggcgcaagtgatcgacgccgcacgtgcgcgagggctgcggctgatcacc
gttggccgcaacggcgacgcaggcgagggcatccggctgatcgaggcgtcgatcgacggc
ttcgcgcagaagctcacgatcgaacatgccggccgccgcaccgcggtgcatctgccgctg
gtcggcgaattccagatcgagaacgcgctggtcgcggccgggctggtgatcggcgccggc
ggcgatccggcggcggcgttcgcggcgctggatcatctcgagggcgccccgggccggctc
gatttcgtcggcgagcgccgcggcgcgccggtgttcgtcgactacgcgcacaagcctgat
gcgctggcgaaggcgctgcaggcgctgcggccctacgcgaagcgcaagctcgtcgtggtg
ttcggcgccggcggcgatcgcgacgccggcaagcggccgctgatgggcgcgatcgcagcc
gggaacgccgacagcatcatcgtcaccgacgacaatccgcgcagcgaagaccctgccgca
atccgggccgccatcctcgccgccgcgccgggagcgcgcgagatcggggatcgcgccgaa
gcgatccgcaccgcgatcgccgcgctggcgccgggcgatgcgctgctgatcgccggcaag
ggccatgagaccgggcagatcgtgcgcgacacggtgctgccgttcagtgatcacgaagcc
gccgcggcggcgttgtcgacgagtgccggatga

DBGET integrated database retrieval system