KEGG   Rhodopseudomonas palustris BisB5: RPD_3470Help
Entry
RPD_3470          CDS       T00345                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RPD_3470
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RPD_3470
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RPD_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3849939..3850415)
Genome map
AA seq 158 aa AA seqDB search
MTSIQDFTAKTLAGEELPLKRFEGQVLLIVNTASACGFTPQYKGLEALQKTYGPRGFSVL
GFPCNQFGAQESGNETEIAQFCSTNYGVSFPMFAKIDVNGANAHPLYKFLKDEKSGLLGS
AIKWNFTKFLVDRAGHVVSRHAPTTTPESLAKDIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgattcaggacttcacggccaagacactcgcgggcgaggagctgccgttgaag
cggttcgaaggccaggtgctgctgatcgtcaacaccgccagcgcctgcggattcactccg
caatacaagggcctcgaagcgctgcagaaaacctacggaccacgcggcttttcggtgctg
ggctttccctgcaaccagttcggcgcgcaggagtccggaaacgaaaccgagattgcgcaa
ttctgctcgaccaactacggcgtcagctttccgatgtttgcgaagatcgacgtcaatggc
gcgaacgcgcatccgctgtacaagtttctgaaggatgagaaatccggcctgctcggttcg
gcgatcaaatggaatttcaccaaattcctggtcgatcgcgccggccatgtggtatcgcga
cacgcgccgacgaccacgccggagtcgctcgcaaaggatatcgagacgctgctatga

DBGET integrated database retrieval system