KEGG   Rhodopseudomonas palustris BisB5: RPD_3484Help
Entry
RPD_3484          CDS       T00345                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPD_3484
Enzymes [BR:rpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RPD_3484
Exosome [BR:rpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPD_3484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3870543..3872693
Genome map
AA seq 716 aa AA seqDB search
MTVQLTDEAYAVLEGRHADPFHYLGPHSEDNRVVVRALLPDATAVEAVGEHGETAHLERV
HESGLFAGSLPNGSHRYQLRARFGDTTVDLEDPYRFPPILTDFDLYLLGEGTDQRLYDKL
GAHPMALEGVNGVAFVVLAPNARRVSVVGDFNFWNPRRHQMRVRGNGYWELFVPGAAAGD
HYKFDVVGPHGEQLPQKSDPMAFAAELRPKTASIVVDQTRLPQPRPAPAQINALGAPMSI
YEVHLGSWRRKDGEQWLSYRELAETLPAYVREMGFTHVEFLPVSEHPFDGSWGYQPTGLY
APTSRFGTPEDFCALIDAFHAQGIGVLLDWVPGHFPDDPHGLGHFDGTALYEHANPLQGR
HLDWGTLIYNYGRTEVVNFLVSNALFWLERYGIDGLRVDAVASMLYLDYSRPADGWVPNK
FGGRENIEAIDFLRRFNAEVFAKFPHVTTAAEESTAWPQVSRPVEFGGLGFGYKWNMGWM
HDTLNYISKDPIHRKFHHGQILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDEWQR
FANLRAYYAFMFAHPGKKLMFMGSEFGQEREWNHDRSLDWHLLDTPKYAGIQALVRDLNR
LYRTLPALHQLDCDPFGFEWLVTDDADRNVFAWMRKGDDPRARCLVIANFSPNVYEDYRV
RVPFPGRWREALNSDSAVYGGSNVGNAGEVHTLDGLVPELSLTIPPLAAIFLTPED
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcaactgaccgacgaggcttacgcggtcctggaaggccgccacgccgatccg
tttcactatttgggcccgcattcggaagacaaccgcgtcgttgtgcgggcgctgctgccg
gacgcaacggcggtcgaggcggtcggcgaacacggcgagacggcgcatctcgaacgcgtc
cacgaatccgggctgttcgcgggatcgctgccgaacggatcgcaccgctaccagcttcgc
gcccggttcggcgataccaccgtcgaccttgaggatccctatcgctttccgccgatcctg
accgacttcgacctgtacctgctcggcgaaggcaccgaccagcggctctacgacaagctc
ggcgcgcacccgatggcgcttgaaggcgtcaacggcgtcgctttcgtggtgctcgcgccg
aacgcgcgccgcgtcagcgtggtcggcgatttcaatttctggaatccgcgccggcatcag
atgcgggtgcgcggcaacggatattgggagctgttcgtccccggcgccgccgccggcgat
cactacaagttcgatgtcgtcggccctcacggcgagcaactgccgcagaaatccgacccg
atggcgttcgccgccgagctgcggccgaagaccgcctcgatcgtggtcgatcagacccgg
ctgccgcaaccgcggcccgcgccggcccagatcaacgcgctcggcgcgccgatgtcgatc
tacgaggtgcatctcggctcgtggcggcgcaaggacggcgagcaatggctgagctatcgc
gagctcgccgagacgttgccggcctatgtgcgcgagatgggcttcacccatgtcgaattc
cttccggtcagcgaacatccgttcgacggctcctggggctatcaaccgaccgggctttac
gcgccgaccagccggttcggcacgccggaggatttctgtgcgctgatcgacgccttccac
gcgcagggcatcggcgtgctgctcgactgggtgcccggccacttccccgacgatccgcac
ggcctcggccatttcgacggcaccgcgctgtacgaacacgccaacccgctgcaggggcgg
catctcgactggggcacgctgatctacaattacggccgcaccgaagtggtgaacttcctg
gtgtcaaacgcactgttctggctggagcgttacggcatcgacggcctgcgggtcgatgcg
gtggcgtcgatgctgtatctcgactacagccgaccggccgacggctgggtcccgaacaag
ttcggcggccgcgagaacatcgaggcgatcgatttcctgcgccgtttcaacgccgaagtg
ttcgccaaatttccgcacgtcaccaccgcggccgaagagtcgaccgcctggccgcaggtg
tcgcggccggtcgagttcggcgggctcggcttcggctacaagtggaacatgggctggatg
cacgacacgctgaactacatcagcaaggatccgatccaccgcaagttccaccacggccag
atcctgttcgggttgcactacgcgttctcggagaacttcatcctgccgctgtcgcacgac
gaggtcgtgcacggcaaacgttcgatcctcggccggatgccgggcgacgagtggcagcgc
ttcgccaatctgcgcgcgtactacgccttcatgttcgcccaccccggcaagaagctcatg
ttcatgggcagcgagttcggccaggagcgggagtggaatcacgaccgttcgctggactgg
catctgctggacaccccgaaatacgccggcatccaggcgctggtccgcgacctcaacagg
ctgtatcgcacgctgccggcgctgcatcagctcgactgcgatccattcgggttcgaatgg
ctcgtcaccgacgacgccgaccgcaacgtgttcgcctggatgcgcaagggcgacgacccc
cgcgcgcgctgcctggtgatcgccaacttctcacccaatgtctatgaggactaccgcgtt
cgggtgccgttccccggccgatggcgcgaggcgctcaactccgattccgcagtctacggc
ggcagcaacgtcggcaatgccggcgaagttcacacccttgacggcttggtgcccgagctt
agtttgaccattccgccgctcgccgcgatctttctcacgccggaagactga

DBGET integrated database retrieval system