KEGG   Rhodopseudomonas palustris BisB5: RPD_3495Help
Entry
RPD_3495          CDS       T00345                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPD_3495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_3495
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_3495
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPD_3495
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPD_3495
   00626 Naphthalene degradation
    RPD_3495
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPD_3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3885683..3886735)
Genome map
AA seq 350 aa AA seqDB search
MKSFRVSGFGQPLSEDNRPTPELTGTQVLVRVKAAGICHSDLHIWEGGYELGHGRKKLSL
ADRGVSLPLTMGHETVGEVVAAGPDAKDAKIGDVALVYPWIGCGQCEVCRAGDENMCLKP
RFLGVYCDGGYSDELIVPHPRYLLSLEGLDPVTAAPYACSGVTTYSALKKLEFAFAGPIV
MFGAGGLGLMALSLLKAMGGKGAIMVDIDASKREAAEKAGAMATVDGAAPDALEQIAAKA
GAPVRGALDLVGNAQTAQLGFDCLTKGGKLVIVGLFGGGAPWALPFIPMRAITIQGSYVG
NLRETQELLDLVRTKKIAPIPVTPLPLQKANDALIDLQNGRLVGRAVLTP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagagctttcgcgtctccggcttcggtcagccgctcagcgaagacaaccggccgacg
ccggaattgaccggcacgcaggtgctggtccgcgtcaaggccgccggcatctgccacagc
gatctgcacatctgggaaggcggctacgaactcggccacggccgcaagaaattgtcgctc
gccgatcgcggcgtatcgctgccgctgacgatgggccacgagaccgtcggcgaagtggtt
gccgccggtccggatgcgaaggatgccaagatcggcgacgtcgcgctggtctatccgtgg
atcggctgcggccaatgcgaggtctgccgcgccggtgacgagaacatgtgcctgaagccg
cgcttcctcggcgtgtattgcgacggcggctattcggacgaactgatcgtgccgcatccg
cgctatctgctcagcctcgaaggtctcgatccggtgacggccgcgccctacgcctgttcg
ggcgtcaccacctacagcgcgctgaagaaactcgaattcgcgttcgccggtccgatcgtg
atgttcggcgccggcgggctcggcctgatggcgctgtcgctgctcaaggcgatgggcggc
aagggcgcgatcatggtcgatatcgacgccagcaagcgcgaagccgccgaaaaggccggc
gcgatggcgacggtcgatggcgcggcgccggatgcgctggagcagatcgccgcgaaagcc
ggcgctccggtgcgcggtgcgctcgatctggtcggcaacgcccagaccgcgcagctcggt
ttcgactgtctcaccaagggcggcaagctggtgatcgtcgggctgttcggcggcggcgcg
ccatgggcgctgccgttcatcccgatgcgggcgatcaccatccagggcagctatgtcggc
aatctgcgcgagacgcaggaattgctcgacctcgtgcgtaccaagaagatcgcgccgatc
ccggtcacgccgctgccgctgcagaaggcgaacgatgcgttgatcgacctgcagaacggc
aggctggtcggccgtgcggtgttgacgccgtag

DBGET integrated database retrieval system