KEGG   Rhodopseudomonas palustris BisB5: RPD_3544Help
Entry
RPD_3544          CDS       T00345                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rpd00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3937805..3939307)
Genome map
AA seq 500 aa AA seqDB search
MPFVMAIDQGTTSSRAILFRGDISIAASAQQEFPQHFPASGWVEHEPEDIWNSTLSTCRA
AMEKAGARASDIAGIGITNQRETVVVWDRVSGQAIHRAIVWQDRRTADVCTRLKADGYEP
MITDKTGLIVDPYFSGTKVAWLLDNVPGARGRAERGELMFGTIDCYLLWRLSGGTVHATD
ATNASRTLLFNIHTGEWDDELLKLLRVPRSMLPEVKDSSAHFGDSAYELFGGSIAIRGIA
GDQQAATIGQACFTPGMIKSTYGTGCFALLNTGAKPVRSNNKLLTTIAYQLDGKRSYALE
GSIFVAGSAVQWLRDGLGIIKHASETGPLADKSDSMQSVYLVPAFVGLGAPYWNPRVRGA
LFGMTRNTGPAELAHATLESVCYQTYDLWAAMRADWPDADAAPPVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLSAGVYPEPQKFADNWRLDRRFKPAMSAATRE
RKLAGWGRAVKGLLASDEGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgtgatggccatcgatcagggcaccacctcgtcgcgcgcaattttgttccgc
ggcgacatctcgatcgcggcgtccgcgcagcaagagtttccgcagcattttccggcctcg
ggctgggtcgagcacgagccggaggacatctggaattcgacgctgtcgacctgccgcgct
gcgatggagaaggccggcgccagggccagcgatatcgccgggatcggcatcaccaaccag
cgcgagaccgtggtggtgtgggaccgcgtctccggtcaggcgatccaccgcgccatcgtc
tggcaggaccggcgcaccgcggatgtctgcacccggctcaaagccgacggctatgagccg
atgatcaccgacaagaccggcctgatcgtcgatccgtatttctccggcaccaaggttgca
tggctgctcgacaatgtgcccggcgcgcgcggacgcgccgagcgcggcgagctgatgttc
ggcaccatcgattgctatctgttgtggcggctgagcggcggcacggttcacgccaccgac
gccaccaacgcctcgcgcacgctgctgttcaacatccacaccggcgagtgggacgacgaa
ctgctgaagctgctgcgggttccgcgctcgatgctgccggaggtcaaggattcctcggcg
catttcggcgacagcgcctacgagctgttcggtggcagcatcgcgatccgcggcatcgcc
ggcgaccagcaggccgcgaccatcggccaggcctgcttcacccccggcatgattaaatcg
acctatggcaccggctgcttcgcgctgctcaacaccggcgcgaagccagtgcgttcgaac
aacaagctgctcaccaccatcgcctatcagctcgacggcaagcgctcctacgcgctggag
ggctcgatcttcgtcgcaggcagcgcggtgcagtggctgcgcgacgggctcggcatcatc
aagcacgccagcgaaaccggtccgctcgccgacaaatccgattcgatgcagagcgtctat
ctggtgccggccttcgtcggcctcggcgcaccgtactggaatccgcgggtgcgcggtgcg
ctgttcggcatgacgcgcaacaccgggccggccgaactcgcccacgccacgctggagagc
gtctgctaccagacctacgatctgtgggcggcgatgcgcgccgattggcccgatgcggac
gcggcccctccggtgctgcgcgttgacggcggcatgaccgcgtcggactggaccatgcaa
cgcctcgccgatctgctcgacgccccggtcgatcgcccggtgatccaggagaccacggcg
ttgggcgcggcctatctcgccggcctcagcgccggcgtctatcccgaaccgcagaaattc
gccgacaactggcggctcgatcgccgcttcaagccggcgatgagcgcggccacgcgcgag
cgcaagctggcgggatggggacgggcggtgaaggggttgctggcgagcgacgagggggag
tag

DBGET integrated database retrieval system