KEGG   Rhodopseudomonas palustris BisB5: RPD_3675Help
Entry
RPD_3675          CDS       T00345                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rpd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4101737..4102894)
Genome map
AA seq 385 aa AA seqDB search
MSVALAGNPASTSTQYEPLRVMIVDDSVVIRGLISRWIEAEPDMVVAASLRTGLDAVNQV
ERIKPDVAVLDIEMPELDGISALPKLLAKKRDLIIIMASTLTRRNAEISFKALSLGAADY
IPKPESTREASAADIFKHDLLQKIRHLGGKVRRKASAASSTAAPALMREPAAPAHSVASQ
AALVKRPFGVTAPRVLLIGSSTGGPQALMSLVSEIGSVIDHYPVLITQHMPPTFTTILAE
HLMRSARRPAHEGVDGEVVKSGQIYLAPGGRHMRVVRQGGQAVIALDDGPPVNFCKPAVD
PLFNSAIDVWQSGILAVVLTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMPGAAANA
GICAAVLPLNQIGPKLVRLFSGDRS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagcattggcaggtaatccggcctcgacttcgacgcagtatgagcctctgcgc
gtgatgatcgtcgacgactccgtcgtcatccgcggtttgatctcgcgctggatcgaggcg
gagccggacatggtggtcgcggcctcgctacgcacggggctcgatgccgtcaatcaggtc
gagcgcatcaaacccgatgtcgcagtgctcgacatcgagatgcccgaactcgacggcatt
tcggcgttgccgaagctgctcgccaagaagcgcgatctgatcatcatcatggcttcgacg
ctgacgcgccgcaatgcggagatcagcttcaaggcgctgtcgctcggcgccgccgactac
attccgaagcccgaatcgacccgcgaggcgtcggccgccgatatcttcaagcacgatctg
ctgcagaagatccggcatctcggcggcaaggttcggcgcaaggcgtcggccgcgagctcc
accgctgcacccgcgcttatgcgcgagccggccgcgccggcgcacagcgtcgcaagtcag
gcggcgctggtgaagcgcccgttcggcgtgacggcgccgcgcgtgctgctgatcggctcc
tcgaccggcggcccgcaggcgctgatgtcgttggtgagcgagatcgggtcggtcatcgac
cactatccggtgctgatcacccagcatatgccgccgacctttaccaccattctcgccgaa
catttgatgcgctccgcacggcggcctgcgcacgaaggcgtcgatggtgaagtcgtcaag
tccggtcagatctatctcgcgccaggcggtcgccatatgcgggtggtgcggcagggcgga
caggccgtgatcgcgctcgacgacggcccgccggtgaacttctgcaagcccgcggtcgac
cctctgttcaactcggcgatcgatgtttggcagagcggaattctcgccgtggtgctgacc
ggcatgggctcggacggcatgcgcggcggcaaggacatcgtcgcggccggcggcagcgtg
atcgcgcaggacgaagcgagcagcgtggtatggggaatgcccggcgccgcggcgaatgcc
ggcatctgcgccgcggttttgccgctcaatcagatcgggccgaaacttgtgaggttgttt
tctggagatcggtcgtga

DBGET integrated database retrieval system