KEGG   Rhodopseudomonas palustris BisB5: RPD_3680Help
Entry
RPD_3680          CDS       T00345                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RPD_3680
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RPD_3680
Transfer RNA biogenesis [BR:rpd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RPD_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4107631..4108467
Genome map
AA seq 278 aa AA seqDB search
MATGQALGQGPAVSNDAAAALMQPLTDLVLRAGAAILAVDRSAPVEQKPDGSPVTIADLA
ADRIIAEGLTQLALGIPALSEERCALGRAASGSFFLIDPLDGTKDYVAGRDEFTVNLALV
TDGKPLLGIVGAPALGLVWRGLVGHGAERLTIGADGKVATAAPIHTRPMPSTGDPWIVAI
SRLHLDDRTVAFIESRPGAVRAPMGSALKFCRIAEGEADIYPRLAPTCEWDIAAGAAVVI
AAGGRLTDGSGASLRFDEPRPNFIVPEFIAWGDPRAAG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggggcaggcattgggacaaggaccggccgtttcgaacgatgccgccgccgcc
ctgatgcagccgctgaccgacctggtgctgcgggccggcgctgcgatcctggcggtcgac
cgctccgcgccggtcgagcaaaagcccgacggctcgccggtgacgatcgcggatctcgcc
gccgaccggatcattgccgaagggctgacgcaacttgcgctggggattcccgcgctgtca
gaagaacggtgcgcgctcggtcgcgccgcctcgggcagcttcttcctgatcgacccgctc
gacggcaccaaggattatgtcgcgggccgcgacgaattcaccgtcaatctggcactggtg
accgacggcaaaccgctgctcggcatcgtcggcgcgccggcgctcgggctcgtgtggcgc
ggactggtcggccatggcgccgagcgcctgacaatcggcgccgacggcaaggtcgccacc
gccgcgccgatccacacccgaccgatgccgtccaccggcgacccctggatcgtggcgatc
agccggctgcacctcgacgaccgtaccgtggctttcatcgagagccggccaggcgcggtg
cgagcgccgatgggctcggcgctcaaattctgccggatcgccgaaggcgaggccgacatc
tatccgcggctggcgccgacctgcgaatgggatatcgccgcgggcgctgcggtggtgatc
gcagccggcggccgcctgaccgacggcagcggcgcctcgctgcggttcgacgagccgcgg
ccgaatttcattgtgccggaattcattgcctggggcgatccccgagcggcaggctga

DBGET integrated database retrieval system