KEGG   Rhodopseudomonas palustris BisB5: RPD_3742Help
Entry
RPD_3742          CDS       T00345                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RPD_3742
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPD_3742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4180792..4181211
Genome map
AA seq 139 aa AA seqDB search
MVRKLLAIVTITAAAGSLSTGTASAQDAAKGEAVFKQCMTCHRADKNMVGPALGGVVGRK
AGTAAGFTYSPLNHNSGEAGLVWTQENIIAYLPDPNAYLKKFLTDKGQADKATGSTKMTF
KLANDQQRKDVAAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgaaaacttctcgcaattgtcaccatcaccgctgccgcaggatctctgtcgaca
ggtaccgcctcggcgcaggacgccgccaagggcgaagccgtgttcaagcagtgcatgacc
tgccatcgcgccgacaagaacatggttggtccggcactcgggggcgtcgtcggccgtaag
gcaggcaccgctgccggcttcacctactcgcctctgaaccacaattccggcgaggccggt
ctggtctggacccaggaaaacatcatcgcctacctcccggatccgaatgcctatctgaaa
aagttcctgaccgacaagggccaggccgacaaggccacgggttctaccaagatgaccttc
aagctggccaacgatcagcagcgcaaggacgtcgcggcatatcttgccacgctcaagtaa

DBGET integrated database retrieval system