KEGG   Rhodopseudomonas palustris BisB5: RPD_3742Help
Entry
RPD_3742          CDS       T00345                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPD_3742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABE40963
JGI: RPD3742
UniProt: Q132M6
Position
4180792..4181211
Genome map
AA seq 139 aa AA seqDB search
MVRKLLAIVTITAAAGSLSTGTASAQDAAKGEAVFKQCMTCHRADKNMVGPALGGVVGRK
AGTAAGFTYSPLNHNSGEAGLVWTQENIIAYLPDPNAYLKKFLTDKGQADKATGSTKMTF
KLANDQQRKDVAAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgaaaacttctcgcaattgtcaccatcaccgctgccgcaggatctctgtcgaca
ggtaccgcctcggcgcaggacgccgccaagggcgaagccgtgttcaagcagtgcatgacc
tgccatcgcgccgacaagaacatggttggtccggcactcgggggcgtcgtcggccgtaag
gcaggcaccgctgccggcttcacctactcgcctctgaaccacaattccggcgaggccggt
ctggtctggacccaggaaaacatcatcgcctacctcccggatccgaatgcctatctgaaa
aagttcctgaccgacaagggccaggccgacaaggccacgggttctaccaagatgaccttc
aagctggccaacgatcagcagcgcaaggacgtcgcggcatatcttgccacgctcaagtaa

DBGET integrated database retrieval system