KEGG   Rhodopseudomonas palustris BisB5: RPD_3770Help
Entry
RPD_3770          CDS       T00345                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPD_3770 (bchD)
Enzymes [BR:rpd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPD_3770 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4207334..4209100)
Genome map
AA seq 588 aa AA seqDB search
MSISLAWSDAVTAAQLFAVDPVGTGGVLLRSRAGPVRDRWLATLRAALPPDQPYRNLPLH
IADGRLLGGLDLSATLLAGRPVAERGLLAEADGGVLVVAMAERMQASTNVYLTAAMDAQE
TAVERDGLSLRMPARFGVVALDEGLEDEFAPAGLRDRLGFHLDLDQFAWRDTEDFPVQLD
DIIAARARLAGIKVGREQIEAICSAAAALGIISLRAPLLAIRAARASAALFDRVTIEQDD
ITLAARLVLAPRAMVFPQSDQPDEAEPPPPEPPPEDNSEDNNDQEQQTPDIDRALDEVIL
AAVKAAMPPGVLEALRASAGRARARSAGKAGELQKSKKRGRPTGSVRGELRDGSKLNVIE
TLRAAAPWQPLRRRQAEGRPGSAPRILVEKDDFRIARFKQRTETITIFVVDASGSAALHR
LAEAKGAVELLLADCYVRRDQVAMIAFRGSIAEILLPPTRSLARAKRSLAGLPGGGGTPL
AAGLDAAFMLADSIKRKGQTPTVIVLTDGRANIARDGAPGRPQAEEDAKASARQFRVAAI
NSVVIDMSPRPGPQAESFAKEMDARYLPMPHADATVLAKAVTAATRAG
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctcgctcgcatggtccgatgcggtgaccgcggcgcagttgttcgcggtcgac
ccggtcggcaccggcggtgtgctgctgcgctcgcgcgcggggccggtgcgcgaccgctgg
cttgcgacgctgcgcgccgcgctgccgcctgatcaaccctacagaaacctgccgctgcat
attgccgacggtcgcctgctcggcggcctcgatctgtccgcgacgctgcttgccggccgc
ccggtcgccgagcgcggtctgctggcggaagccgatggcggcgtgctggtcgtggcgatg
gcggagcgaatgcaggcctcgaccaacgtgtatctcactgcggcgatggacgcgcaggag
accgcggtcgagcgcgacggtctgtcgttgcggatgccggcgcggttcggcgttgtggcg
ctcgacgaaggcctcgaggacgagttcgcgcccgccggtctgcgtgatcggctcggcttc
catctcgatctcgatcagttcgcctggcgtgacaccgaggatttcccggtgcagctcgac
gacatcatcgcggcccgtgcgcgtcttgctggaattaaagtcggtcgtgagcagatcgaa
gcgatctgctcagccgccgcggcgctcggcatcatctcgctgcgtgcgccgctgctggcg
atccgcgcggcgcgggcgagcgcggcgctgttcgaccgggtcaccatcgagcaggacgac
atcacgcttgccgcgcggctggtgctggcgccacgcgcgatggtctttccgcagtccgat
cagccggacgaggccgaaccgcctccgcccgagccgccgccggaagacaattccgaggac
aacaacgaccaggaacagcagacgccggatatcgaccgcgcgctcgacgaggtgatcctc
gccgcagtcaaggcggcgatgccgcccggcgtgctggaagcgctgcgggcttccgccggc
cgtgcgcgagcccgctcggccggcaaggccggcgagctgcagaagtcgaagaagcgcggc
cgcccaaccggcagcgtgcgcggcgaattgcgcgacggctccaagctcaacgtcatcgag
acgctgcgcgccgcggcgccgtggcagccgctgcgccggcgtcaggcggaaggccgcccc
ggcagcgcgccgcgtattctcgtcgagaaggacgatttccgcatcgcgcgcttcaagcag
cgcaccgagaccatcaccatcttcgtggtcgacgcctcgggctcggcggcgctgcatcgt
ctcgccgaagccaagggcgcggtcgaattgttacttgccgattgctacgtgcgccgcgac
caggtggccatgatcgcgttccgcggcagcatcgccgaaatcctgctgccgccgacgcga
tcgttggcgcgcgccaagcgcagcctcgcgggtctgccgggcggcggcggcacgccgctc
gcagccggactcgacgcagcgttcatgctggccgattcgatcaagcgcaaaggtcagacg
ccgaccgtgatcgtgctgaccgacggccgcgccaacatcgcgcgcgacggcgcgccgggc
cggccgcaggccgaggaagacgccaaggcgtcagcgcggcaattccgtgtcgcggcgatc
aattcggtggtgatcgacatgtcgccgcggccggggccgcaggccgagtccttcgccaag
gaaatggacgcacgctatttgccgatgccccacgccgacgccaccgtcttggcgaaagcg
gtgaccgcagcgacgcgcgccggctga

DBGET integrated database retrieval system