KEGG   Rhodopseudomonas palustris BisB5: RPD_3984Help
Entry
RPD_3984          CDS       T00345                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPD_3984
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_3984
   00620 Pyruvate metabolism
    RPD_3984
   00640 Propanoate metabolism
    RPD_3984
  Energy metabolism
   00680 Methane metabolism
    RPD_3984
Enzymes [BR:rpd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RPD_3984
Lipid biosynthesis proteins [BR:rpd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RPD_3984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4430991..4432598)
Genome map
AA seq 535 aa AA seqDB search
MLTETSDYDSLYRDFRWSVPARFNIATAACDRHAIGDKPALIYVDEAGAVTRMSFAEIAS
ASRRFANVLKAAGLARGDRVAVFLSQSIELPIAHLAAFRSGLVSVPLFTLFGEDALEFRL
SNSGARAVITDESGLPKLLRIRDRLPELRQIYVTGGAAPSGVELFWSKLDAASDAFETVD
TSCDDPAIIIYTSGTTGNPKGALHAHRVLLGHLPNVEMAHDFFPRPGDLMWTPADWAWIG
GLFDALFPAWYHGVAMLGHRARKFEPQAAMQLMADHGVRNVFLPPTALKLMRQADVKHPG
VKLRSIFTGGESLGGELLAWVRATFGVDAHEIYGQTECNLVVGNNARLFPIRPGSMGKAT
PGFDVRIVDEDGRELPCGERGIIGVRQPNPCTMLEYWKNPEATAKKFAGGFLLTGDLARQ
DGDGYFWYDSREDDVITSAGYRIGPSEIEHTLLKHPAVAFAAVVGVPDPIRTEAIKAWIV
LRPGFAKGDALAREIQNFVKVQLAAHEYPRHVEFTETLPMTATGKVLRRELRAKG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgaaacctccgactacgatagcctctaccgcgatttccgttggtcggttccc
gcccgcttcaacatcgcgaccgcggcgtgcgatcggcacgcgatcggcgacaagccggcg
ctgatctatgtcgacgaagccggcgcggtcacgcggatgtcgttcgccgagatcgccagc
gcctcgcgccgcttcgccaatgtgctgaaggccgccggcctcgcgcgcggcgaccgcgtc
gcggtgttcctgtcgcaatcgatcgagctgccgatcgcgcatctcgcggcgttccgttcg
gggctcgtctcggtgccgttgttcacgctgttcggcgaggacgcgctggagtttcgtctg
tcgaattccggcgcccgcgcggtgatcaccgatgagagcgggctgccgaagctgctcagg
atccgcgaccgcctgccggagttgcggcagatctacgtcaccggaggcgcggcgccgtcc
ggcgtcgagctgttctggtccaagctcgatgcggcgtccgatgcgttcgagacggtcgac
acctcctgcgacgatcccgcgatcatcatctacacctcgggcacgaccggtaacccgaaa
ggcgcgctgcacgcccatcgcgtgctgctcggccatctgccgaatgtcgagatggcgcac
gacttctttccgaggcccggcgacctgatgtggacgccggcggattgggcgtggatcggc
ggattgttcgatgcgctgtttccggcctggtatcacggcgtcgcgatgctcggccaccgc
gccagaaagttcgagccgcaggccgcgatgcagctgatggccgatcacggcgtccgcaac
gtgttcctgccgccgaccgcgctgaagctgatgcggcaggcggatgtgaaacatcccggc
gtcaagttgcgcagcatcttcaccggcggcgagtcgctcggcggcgaattgctggcctgg
gtgcgcgccactttcggcgtcgatgcgcacgagatctacggccagaccgaatgcaatctg
gtggtcggcaacaacgcaaggctgtttccgatccgtcccggctcgatgggcaaggcgacg
ccgggtttcgatgtccgcatcgtcgatgaagacggccgggaactgccgtgcggcgagcgc
ggcatcatcggcgtgcgccagcccaatccctgcaccatgctggaatattggaagaacccg
gaggcgaccgcgaagaaattcgcaggcggcttcctgctcaccggagatctggccaggcag
gacggcgacggttacttctggtacgacagccgcgaggacgatgtcatcacctcggccggc
tatcgcatcggcccgtcggagatcgagcacacgctgctgaagcatccggcggtggcgttc
gccgcggtggtcggcgtgcccgatccgatccgcaccgaagcgatcaaggcctggatcgtt
ctgcgcccgggcttcgccaagggcgacgcgttggcgcgcgagatccagaatttcgtcaag
gtccagcttgccgcccacgaatatccccgccacgtcgaattcaccgagacgttgccgatg
accgcgaccggcaaggtgctgcgccgcgagctgcgggcgaaggggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system