KEGG   Rhodopseudomonas palustris BisB5: RPD_4053Help
Entry
RPD_4053          CDS       T00345                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rpd01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rpd00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4503056..4504693)
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGISDRAIQGPSSYQSEIEAAEALLKDQPTWNGVKAEAVARMRLQNRFKTGLDVA
RYTAALMRADMAAYDADSTKYTQSLGCWHGFIAQQKLISVKKHFGTTDRTYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNTIFRDLDAARKAGDKAKEAA
LIEKIDNFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHEVFLAKIRACRHAFLELGVEDGVIVTRTDSLGAGLTQQIAVSHQPGDIGDQYN
SFLDCEEVDATKVGNGDVIISRNGKLLRPKRLASNLYQFREGTGADRCVLDSITSLQNGA
DLLWIETEKPNIEQIASMVDRIREVVPNAKLAYNNSPSFNWTLNFRWQVYDEMKKAGKDV
SQYNRAELMKAEYDSTPLAIEADELIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
KEYFGEQGMLGYVKNVQRQEIRQGIACVKHQDMAGSNIGDDHKEYFAGEAALKAGGAHNT
MNQFS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccagccacgtgggatcagcgatcgggccattcaggggccgtcctcctatcag
agcgaaatcgaagcggccgaagcccttctcaaggaccagcccacctggaacggcgtgaaa
gccgaggccgtggcccgtatgcgcttgcagaaccgcttcaagaccggcctcgatgtcgcg
cgctacacggctgcgctgatgcgtgccgacatggcggcctacgacgctgacagcacgaaa
tatacccagtcgctcggttgctggcacggcttcatcgcgcagcagaagctgatttcggtg
aagaagcacttcggcacgaccgatcgcacctatctttatctgtccggctggatgatcgcg
gcgctgcgctccgagttcggaccgctgcccgaccagtcgatgcacgagaagacctcggtg
ccggcgctgatcgaagagctctacaccttcctgcgtcaggcggattcccgcgagctgaac
acgatcttccgtgacctcgacgctgcccgcaaggccggcgacaaggcgaaggaagccgcg
ctcatcgaaaagatcgacaatttccagacccacgtcgtgccggtgatcgccgacatcgac
gccggcttcggcaacgccgaggcgacctatctgctggccaagaagatgatcgaagccggc
gcctgcgcgctgcagatcgagaaccaggtgtccgacgaaaagcagtgcggccatcaggac
ggcaaggtgacggtgccgcacgaggtcttcctggcgaagatccgcgcctgccgccacgcc
ttcctcgaactcggcgtcgaagacggcgtcatcgtcacccgcaccgactcgctcggcgca
ggcctgacgcagcagatcgccgtcagccatcagccgggcgacatcggcgaccagtacaac
agcttcctggactgcgaagaggtcgacgccaccaaggtcggtaacggcgacgtcatcatc
agccgaaacggcaagctgctgcgcccgaagcgcctggcgagcaacctgtatcagttccgc
gaaggcaccggtgcggatcgctgcgtgctcgacagcatcacctcgctgcagaacggcgcc
gatctgctgtggatcgagaccgagaagccgaatatcgagcagatcgcctcgatggtcgat
cgtattcgcgaggtggtcccgaacgcgaagctggcctacaataactcgccgtcgttcaac
tggacgctcaacttccgttggcaggtctatgatgagatgaagaaggccggcaaggatgtg
agccagtacaaccgtgccgagctgatgaaggcggagtacgactcgacgccgctggcgatc
gaagccgacgaactgatccggaccttccaggccgattcagccaagcgcgccggcatcttc
catcatctgatcacactgccgacctatcacacggcagcgctgtcgaccgacaatctcgcg
aaggaatatttcggcgagcagggtatgttgggctatgtgaagaatgttcagcgtcaggag
atccgtcagggcatcgcctgcgtgaagcatcaggacatggccggctcgaacatcggcgac
gatcacaaggaatacttcgccggtgaggccgctctgaaggccggcggcgctcacaacacg
atgaaccagttcagttaa

DBGET integrated database retrieval system