KEGG   Rhodopseudomonas palustris BisB5: RPD_4169Help
Entry
RPD_4169          CDS       T00345                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RPD_4169 (ruvA)
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RPD_4169 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4636433..4637050)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGLIDSYGEDYVILDVHGVGYQVHCSSRTLQALPSPGEAATLSIETYVREDQIKL
FGFRTDHEREWFRLLQTVQSVGAKVALAVLSTLPPNDLANAIALRDKAAVARTPGVGPKV
AERIVSELKDKVPALSNVDPAVVQLSGALDDNRAPRPVTDAISALVNLGYGQPQAAAAIA
AAARAAGDDAATAQLIKLGLKELSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaactcaaaggcctgatcgactcttacggcgaggactacgtgatcctcgac
gtccacggcgtcggctatcaggtgcattgctcgtcgcgcacgctgcaggcgctgccgtcg
cccggcgaggcggcgacgctgtcgatcgagacctatgtccgcgaggaccagatcaagctg
ttcggcttccgcaccgatcacgagcgcgaatggtttcgcctgctgcagaccgtgcagagc
gtcggcgccaaggtggcgctggcggtgctgtcgacgctgccgccgaacgatctcgccaac
gccatcgcgttgcgcgacaaggcggctgtggcgcgcacccccggcgtcgggccgaaagtc
gccgagcgcatcgtctccgaactgaaggacaaggtgccggcgttgtcgaatgtcgatccg
gcggtggtgcagctgtccggcgcgctcgacgacaaccgcgcgccgcgcccggtgacagac
gcgatctcggcgctggtcaatctcggctacggccagccgcaagcggccgccgcgatcgcg
gctgcggcccgcgccgccggcgacgacgcagccaccgcgcaactgatcaagctcggcctg
aaggagctgtcgaagtga

DBGET integrated database retrieval system