KEGG   Rhodopseudomonas palustris BisB5: RPD_4279Help
Entry
RPD_4279          CDS       T00345                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPD_4279 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    RPD_4279 (hisD)
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RPD_4279 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4741840..4743165)
Genome map
AA seq 441 aa AA seqDB search
MGLCAAGSFQMPIRLDSASTDFASQFKAFLAMKREVAADIEAATRAIVDDVAARGDAALL
EATAKFDRLKLEASGLRVSAAEVDAAVKLCDPDTIDALKFARDRIEFFHRRQLPKDDRFT
DPLGVELGWRWSAIEAVGLYVPGGTAAYPSSVLMNAIPAKVAGVERVVMVVPSPDGKLAP
LVLAAAQLGGVTEIYRVGGAQAVAALAYGTATIAPVSKIVGPGNAYVAAAKRLVFGRVGI
DMIAGPSEVVVVADNTGNPDWIAADLLAQAEHDANAQSILITDDAALAAEVERAVAAQLK
TLSREKIARASWDAFGAIIKVARLDEAVGLADAIAAEHLEIITADPEAFAAKIRNAGAIF
LGAHTPEAIGDYVGGSNHVLPTARSARFSSGLGVLDFMKRTSILKCGPEQLAALGPAAMT
LGHAEGLDAHARSVGLRLNRR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgggcctttgtgccgccggaagcttccaaatgccaattcgtctcgacagcgccagcacc
gatttcgcctctcaattcaaggccttcctggccatgaagcgcgaggttgcggccgacatc
gaggcggccacccgggccatcgtcgacgacgtcgcggcgcgcggtgatgcggcgctgctc
gaagccaccgcgaagttcgaccgtttgaagctggaagccagcggcctgcgcgtcagcgcc
gccgaggtcgacgccgcggtcaagctgtgcgacccggataccatcgacgcgctgaaattc
gcgcgcgaccgcatcgaattcttccaccgccgacaattgccgaaggacgaccgcttcacc
gatccgctcggcgtcgagctcggctggcgctggagcgcgatcgaggcggtcggcctctat
gtccccggcggcaccgcggcctatccgtcctcggtgctgatgaacgcgatccccgccaag
gtcgccggcgtcgagcgcgtggtgatggtggtgccgtcacccgacggcaagctcgctccg
ctggtactcgccgcggcgcagctcggcggcgtaactgagatctaccgcgtcggcggcgcc
caggcggtggccgcgctggcttacggcaccgcgacgatcgcgccggtctccaagatcgtc
ggccccggcaacgcctatgtggccgccgccaagcggctggtgttcggtcgtgtcggcatc
gacatgatcgcgggtccgtcagaagtcgtggtggtcgccgacaacaccggcaatccggac
tggatcgcggccgatcttctggcgcaggccgagcacgacgccaatgcgcagtcgatcctg
atcaccgacgatgcggcgctggcggccgaggtcgagcgcgccgtcgcggcgcagttgaag
acgctgtcgcgcgaaaagatcgcgcgcgcctcgtgggacgcgttcggcgccatcatcaag
gtcgcccggctcgacgaggcggtcggcctcgcggacgccatcgccgccgagcatctcgag
atcatcactgccgatccggaagccttcgcggccaagatccgcaatgccggcgcgatcttc
ctcggcgcgcatacgccggaggcgatcggcgactatgtcggaggctccaaccacgtgctg
ccgaccgcgcgttcggcgcggttctcctccgggctcggcgtgctcgatttcatgaagcgg
acctcgatcctgaaatgcggtccggagcagctcgccgccctcggacccgcggcgatgacg
ctcggtcacgccgagggactggatgctcatgcgcgctcggtgggactgcgtctgaatcgg
cgatga

DBGET integrated database retrieval system