KEGG   Rhodopseudomonas palustris BisA53: RPE_0033Help
Entry
RPE_0033          CDS       T00400                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpe00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpe00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(36314..38068)
Genome map
AA seq 584 aa AA seqDB search
MIKRFAITAVAMLALNAAASAQTIYPIDRAEILAGSRFDFKVEFSGEVDPAAVKVTVNGQ
EPASAFGRAADFIAREDGKPQSALLLRDVALGKPGRYVIEASAGTERRSVSWNVYDTGPR
KAKNVVLFIGDGMSPAHRVAARLLSKGISEGKSGGKLAIDDMPQMALVATAGTDSIITDS
ANAASAYTTGHKAAVNALGVYADRSASPFDDPKVETIASLAKRKLDVSIGIVTNTEIEDA
TPAAVIAHTRRRGVYDQIVAQYFAAKPEVLMGGGAANFWPKSAAGSKRKDDADYVAKFRD
AGYGIATTAGELTALAAKSDTQKLLGLFAAGNMDGVLDRKFLKGGGVAKNPEQPDLTEQV
AAALAILSKNDNGFFLMVESGMIDKYAHMLDMERAVYDTIMLDNAVAQTRAWAKARGDDT
LILVLADHNHPNALVGTINDDMTTEPNVALRERVGVYDKAGFPNYPAPDAEGYPARVDVS
RRLAIFSASLPDHYETFRPKLDGPNQPTEQADAGTFKANEKYKNVPGAVLRFGNLPAMMN
ASVHSGEDVILTATGPGSDQVHGSMDNTEVFRVMAEALGLGAKD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagcgtttcgccatcaccgcagtggccatgctggcgctgaatgcggccgcatcc
gcgcagaccatctacccgatcgaccgcgccgagattctcgccggcagccggttcgatttc
aaagtcgagttttcgggcgaggtcgatcctgccgcggtgaaggtcacggtcaatggccag
gagcctgcgagcgcgttcggccgcgccgcggatttcatcgcccgcgaggacggcaagccg
caatcggcgttgctgttgcgcgacgtggcgctgggcaagcccggccgctatgtgatcgag
gcttccgccggcaccgagcgccgcagcgtcagttggaatgtctatgacaccgggccgcgc
aaggccaagaacgtcgtgctgttcatcggcgacgggatgtcgccggcgcatcgcgtcgcg
gcgcggctgctgtccaaggggatcagcgagggcaagagcggcggcaagctggcgatcgac
gacatgccgcagatggcgctggtggcgaccgcgggcaccgattcgatcatcaccgattcg
gccaacgccgcctcggcctatacgaccgggcacaaggccgcggtgaatgcgttgggagtc
tatgccgaccgcagcgccagcccgttcgacgatcccaaggtcgagaccatcgcgtcgctg
gcgaagcgcaagctcgatgtttcgatcggcatcgtcaccaacaccgaaatcgaagacgcc
acgccggcggcggtgatcgcccatacaaggcgtcgcggcgtctatgaccagatcgtcgcg
cagtatttcgccgccaagcccgaggtgctgatgggcggcggcgcggcgaatttctggccg
aaaagtgcggccggctccaagcgcaaggacgacgccgactatgtcgccaaattccgcgac
gccggctacggcatcgccaccaccgcgggcgagctcaccgcgctggcggcgaagtccgac
acgcaaaaactgctcgggctgtttgcggccggcaacatggacggcgtgctcgatcgcaaa
ttcctcaagggtggaggcgtcgcgaaaaatcccgaacagccggacctgaccgagcaggtc
gccgccgcgctggctatcctgtcgaagaacgacaacggtttcttcctgatggtggaatcc
ggcatgatcgacaaatacgcgcatatgctcgacatggagcgcgcggtctacgacaccatc
atgctcgacaacgcggtggcgcagacccgcgcatgggccaaggcgcgcggcgacgacacg
ctgatcctggtgctggccgaccacaaccatcccaatgcgctggtcggcaccatcaatgac
gacatgaccaccgagcccaacgtcgcgctgcgcgagcgcgtcggggtctacgacaaggcc
ggctttccgaactatccggcgccggacgccgagggctatccggcgcgggtcgatgtcagc
cgaaggcttgcgatcttttccgcgagtctgccggatcactacgagaccttccggccgaaa
ctcgacgggccgaatcagccgaccgagcaggccgacgccggcaccttcaaggccaacgag
aaatacaagaacgtccccggcgcggtgctgcggttcggcaatctgccggcgatgatgaat
gccagcgtgcattccggcgaggacgtgatcctcaccgccaccggccccggcagcgaccag
gtgcacggctcgatggacaataccgaggtgtttcgcgtgatggccgaggcgctggggctc
ggggccaaggactga

DBGET integrated database retrieval system