KEGG   Rhodopseudomonas palustris BisA53: RPE_0057Help
Entry
RPE_0057          CDS       T00400                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rpe00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rpe00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpe00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(59437..60843)
Genome map
AA seq 468 aa AA seqDB search
MSPARALLTPSERPPLVPPLPPRASETMSTLQRLSAISANAIASWGDRAYQDDIVVGRFF
HRSSFILNAPDAIRHVLVDNWENYARTPAGIRVLRPMLGQGLLLAEGRPWKHQRRTLAPA
FTPRAVASLVPHMLSAIDDTVTALDAARGGPVDLREATQHMALEIAGRTMFSFGMAEHGK
ALRDFVMEYGWKLAQPSLLDLLLPLSWPTPKDVSRALFRRRWTRFIAELMAARRAEGKSD
SAPPRDLFDLMVAARDPETGEAFSEPQLGDQVATMILAGHETTATALFWALYLLALDPQT
QEELAAEARAQAPGPLDVESLKFTRAVVDETLRLYPPAFLIVRAAIGPDVVGGHKVAPHD
AMLIAPWLLHRHEKLWDQPNAFIPARFLPGAPPPDRFAYLPFGVGPRICIGAHFALVEAT
LALAKIVGQFRIELTDSVPVLPVGVVTTQPDRSPPFRITRRSEMGSQS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggctcgagctttgctaacgccgtcggaacggccgcccttggtgccgccgctg
ccgccgcgcgcctctgaaaccatgagcacgctgcagcggctgtcggcgatcagcgccaat
gcgatcgccagttggggcgatcgcgcctatcaggacgacatcgtcgtaggtcggttcttc
caccgttcgagcttcatcctcaacgcgcccgacgcgatccggcacgtgctggtcgacaat
tgggagaactacgcccgcacgcccgccggcatccgcgtgctgcggccgatgctcggccaa
gggctcttattggccgaaggacgaccctggaaacaccagcgccgtacgctggcgccggcg
ttcacgccgcgcgcggtggcctcgctggtgccgcatatgctgtcggcgatcgacgacacc
gtaacggcgctcgacgccgcgcgcgggggcccggtcgacctgcgcgaggcgacgcagcac
atggcgctggagatcgccgggcgcaccatgttctcgttcgggatggccgagcacggcaag
gcgctgcgcgatttcgtcatggaatacggctggaagctggcgcagccgtcattgctcgat
ctgctgctgccattgtcctggccgacgccgaaggatgtgtcgcgcgcgctgttccggcgg
cgctggacccgtttcatcgccgagttgatggcggcgcggcgtgccgaaggcaaaagcgac
agcgcgccaccgcgcgatctgttcgacctgatggtggcggcgcgcgatccggaaaccggc
gaggcgttttccgagccccagctcggcgatcaggtcgccaccatgatcctcgccggccac
gagaccaccgccaccgcgctgttctgggcgctgtatctgctggcgctcgatccgcagacc
caggaggagctcgccgccgaagcgcgcgcgcaggccccgggtccgctcgatgtcgaaagc
ctgaaattcacccgcgcggtggtcgacgagacgctgcggctgtatccgccggccttcttg
atcgtgcgcgccgcgatcggacccgacgtcgtcggcggccacaaggtcgcgccgcatgat
gcgatgctgatcgcgccgtggctgctgcaccggcacgaaaaactctgggaccagcccaac
gccttcatcccggcgcgtttcctgcccggcgcgccgccgccggatcggttcgcctatctg
ccgttcggggtcggcccgcggatctgcatcggcgcgcattttgcgctggtggaagccacg
ctggcgctggccaagatcgttggccagttccgcatcgaattgaccgacagcgtcccggtg
ctgccggtcggcgtggtgacgacgcagcccgaccgctcgccgccgttccgcatcacccgc
cgctcggagatgggcagccagtcatga

DBGET integrated database retrieval system