KEGG   Rhodopseudomonas palustris BisA53: RPE_0057Help
Entry
RPE_0057          CDS       T00400                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_0057
  Amino acid metabolism
   00380 Tryptophan metabolism
    RPE_0057
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RPE_0057
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RPE_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(59437..60843)
Genome map
AA seq 468 aa AA seqDB search
MSPARALLTPSERPPLVPPLPPRASETMSTLQRLSAISANAIASWGDRAYQDDIVVGRFF
HRSSFILNAPDAIRHVLVDNWENYARTPAGIRVLRPMLGQGLLLAEGRPWKHQRRTLAPA
FTPRAVASLVPHMLSAIDDTVTALDAARGGPVDLREATQHMALEIAGRTMFSFGMAEHGK
ALRDFVMEYGWKLAQPSLLDLLLPLSWPTPKDVSRALFRRRWTRFIAELMAARRAEGKSD
SAPPRDLFDLMVAARDPETGEAFSEPQLGDQVATMILAGHETTATALFWALYLLALDPQT
QEELAAEARAQAPGPLDVESLKFTRAVVDETLRLYPPAFLIVRAAIGPDVVGGHKVAPHD
AMLIAPWLLHRHEKLWDQPNAFIPARFLPGAPPPDRFAYLPFGVGPRICIGAHFALVEAT
LALAKIVGQFRIELTDSVPVLPVGVVTTQPDRSPPFRITRRSEMGSQS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggctcgagctttgctaacgccgtcggaacggccgcccttggtgccgccgctg
ccgccgcgcgcctctgaaaccatgagcacgctgcagcggctgtcggcgatcagcgccaat
gcgatcgccagttggggcgatcgcgcctatcaggacgacatcgtcgtaggtcggttcttc
caccgttcgagcttcatcctcaacgcgcccgacgcgatccggcacgtgctggtcgacaat
tgggagaactacgcccgcacgcccgccggcatccgcgtgctgcggccgatgctcggccaa
gggctcttattggccgaaggacgaccctggaaacaccagcgccgtacgctggcgccggcg
ttcacgccgcgcgcggtggcctcgctggtgccgcatatgctgtcggcgatcgacgacacc
gtaacggcgctcgacgccgcgcgcgggggcccggtcgacctgcgcgaggcgacgcagcac
atggcgctggagatcgccgggcgcaccatgttctcgttcgggatggccgagcacggcaag
gcgctgcgcgatttcgtcatggaatacggctggaagctggcgcagccgtcattgctcgat
ctgctgctgccattgtcctggccgacgccgaaggatgtgtcgcgcgcgctgttccggcgg
cgctggacccgtttcatcgccgagttgatggcggcgcggcgtgccgaaggcaaaagcgac
agcgcgccaccgcgcgatctgttcgacctgatggtggcggcgcgcgatccggaaaccggc
gaggcgttttccgagccccagctcggcgatcaggtcgccaccatgatcctcgccggccac
gagaccaccgccaccgcgctgttctgggcgctgtatctgctggcgctcgatccgcagacc
caggaggagctcgccgccgaagcgcgcgcgcaggccccgggtccgctcgatgtcgaaagc
ctgaaattcacccgcgcggtggtcgacgagacgctgcggctgtatccgccggccttcttg
atcgtgcgcgccgcgatcggacccgacgtcgtcggcggccacaaggtcgcgccgcatgat
gcgatgctgatcgcgccgtggctgctgcaccggcacgaaaaactctgggaccagcccaac
gccttcatcccggcgcgtttcctgcccggcgcgccgccgccggatcggttcgcctatctg
ccgttcggggtcggcccgcggatctgcatcggcgcgcattttgcgctggtggaagccacg
ctggcgctggccaagatcgttggccagttccgcatcgaattgaccgacagcgtcccggtg
ctgccggtcggcgtggtgacgacgcagcccgaccgctcgccgccgttccgcatcacccgc
cgctcggagatgggcagccagtcatga

DBGET integrated database retrieval system