KEGG   Rhodopseudomonas palustris BisA53: RPE_0064Help
Entry
RPE_0064          CDS       T00400                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(73938..74684)
Genome map
AA seq 248 aa AA seqDB search
MAMLVTRPQPDNEATAASLRAKGFEVLLAPMLRFEPVAFAADPDAAYGGIIVTSANALRA
IEGQAAVAQLLGLPLFAVGSRTAQAASEVGFKNVIVAGGDASALRDTIVAAARGRKLKKS
DTLLYLSGADIARDLPGELRALGFNIATQTAYKMISVPTLPGDVCDAFAANRVEAVLHYS
GRSARSFLDAARAAGIEISALAIPQCCLSEAVAAVVHEAGAARVIVASQPNEAALFEVLD
RALAPPVR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtggccatgctcgtcacacgcccgcagcccgacaatgaggcgaccgccgcctcgctccgg
gccaagggttttgaggtgctgttggcgccgatgttgcggttcgagccggtggcgttcgcc
gccgatccggatgcggcctatggtggtatcatcgtcaccagcgccaacgcgctgcgcgcc
atcgaaggccaggccgctgtggcgcaattgctgggtttgccgttgtttgccgtcggttcc
cgcaccgcacaagcggcgagcgaggtcgggttcaagaatgtgatcgtcgccggcggcgat
gcctcggcgctgcgcgacaccatcgtggccgcggcgcgcggccgcaagctgaagaagtcg
gacacgctgctgtatctctccggcgccgatatcgcccgcgatcttcccggtgaactacgc
gcgctgggattcaatatcgccacacagaccgcctataagatgatatcagtgccgaccttg
cccggggatgtttgcgacgctttcgcggcgaaccgggtcgaggcggtactgcattattcg
ggacgcagcgcccgttcgtttctggatgcggcgcgggccgcgggcatcgaaatctcggcg
ctggcgatcccgcaatgctgcctgtcagaagcggtcgctgcggtggtgcacgaggccggc
gccgcgcgcgtgatcgtggcgtcgcagccgaacgaggcggcgctgttcgaggtgctggat
cgggcgctggctccgccggtccgctag

DBGET integrated database retrieval system