KEGG   Rhodopseudomonas palustris BisA53: RPE_0069Help
Entry
RPE_0069          CDS       T00400                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rpe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rpe00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
79015..80961
Genome map
AA seq 648 aa AA seqDB search
MSEKIYDVPAEWAKRAFVDDAKYQEMYARSVNDPNGFWKDEAQRVDWIKPFSVVENTSFA
PGNVSIKWFEDGVLNVAANCIDRHLKDRADQVAIIWEGDDPSESRKITYRQLHDEVCKMA
NVLRNRNVQKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFGGFSPDSLAQRITDCASK
VVITADEGLRGGRTVPLKANVDAALRKSSAVDWVVVVKRTGADVFMDDVRDFWYHEAAEM
VTTECPVEPMHAEDPLFILYTSGSTGQPKGVLHTTGGYLVFASMTHQYVFDYHDGDVYWC
TADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFWEVIDKHQVNIFYTAPTAIRA
LMQGGDEPVTKTSRKSLRLLGSVGEPINPEAWEWYHRVVGEDRCPIVDTWWQTETGGILI
TPLPGATKLKPGSATRPFFGVVPQIMDADANVLEGECTGNLCLAKSWPGQMRTVYGDHAR
FEQTYFSAYPGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESSLVAHPQVS
EAAVVGYPHDIKGQGIYAYVTLMTGVEPTEALRKELVAWVRKDIGPIASPDLIQFAPGLP
KTRSGKIMRRILRKIAEDESSTLGDTSTLADPGVVSELVEHRQNKRHV
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagatttacgacgtgcctgccgaatgggccaagcgcgctttcgtcgacgac
gcgaaataccaggagatgtatgcgcgatcggtgaacgatccgaacggattctggaaggac
gaggcccagcgcgtcgactggatcaagccgttctccgtcgtggaaaacacctcctttgcc
cccggcaatgtctcgatcaaatggttcgaggacggcgtgctcaacgtcgccgccaattgc
atcgatcgtcatctgaaggatcgcgccgatcaggtcgcgatcatctgggaaggcgacgat
ccgtcggaatcgcgcaagatcacctatcgccagctgcacgatgaagtctgcaagatggcc
aacgtgctgcgcaaccgcaacgtccagaagggcgaccgcgtcaccatctatctgccgatg
attccggaagccgcgttcgcgatgctggcctgcgcccggatcggcgcgatccactcggtg
gtgttcggcggtttttcgcccgacagcctcgcccagcgcatcaccgattgcgcctccaag
gtagtgatcaccgccgacgagggcctgcgcggcggccgcactgtgccgctgaaggccaat
gtcgacgccgcgctgcgcaagtccagcgccgtcgattgggtggtcgtggtcaagcgcacc
ggcgccgacgtgttcatggatgacgtccgcgacttctggtatcacgaggccgccgagatg
gtgaccacggaatgcccggtcgagccgatgcatgccgaggatccgctgttcattctctac
acctcgggctccaccggccagcccaagggcgtgctgcacaccaccggcggctatctggtg
ttcgcgtcgatgacgcaccaatacgtgttcgactatcatgacggcgacgtctattggtgc
accgccgacgtcggctgggtcaccggccacagctacatcctctacgggccgctggccaac
ggcgccaccacgctgatgttcgagggcgtgccgaactacccgaccaattcgcggttctgg
gaagtgatcgacaagcaccaggtcaacatcttctacaccgcgccgaccgcgatccgcgcc
ttgatgcagggcggcgacgagccggtgacgaagacctcgcgcaaaagcctgcggctgctg
ggttcggtcggcgagccgatcaatccggaagcctgggaatggtatcaccgcgtggtcggc
gaggaccgctgcccgatcgtcgatacctggtggcagaccgaaaccggcggcatcctgatc
acgccgctgccgggcgcgaccaagttgaagcccggctcggcgacccggccgttcttcggc
gtggtgccgcagatcatggacgccgacgccaatgtgctggagggcgaatgcaccggcaat
ctgtgcctggccaaatcctggcccgggcagatgcgcacggtctatggcgaccacgcccgc
ttcgagcagacctacttctcggcctatccgggcaaatacttcaccggcgacggctgccgg
cgcgacgccgacggctattactggatcaccggccgggtcgacgacgtcatcaacgtctcc
ggccaccgcatgggcacggcggaagtggaatcctcgctggtggcgcatccgcaggtgtcg
gaagccgccgtcgtcggctatccgcacgacatcaagggccagggcatctacgcctatgtc
acgttgatgaccggcgtcgagccgaccgaggcgctgcgcaaggagctggtggcctgggtc
cgcaaggacatcggcccgatcgcctcgccggatctgatccagttcgcccccggcctgccc
aaaacccgctccggcaagatcatgcgccgcatcctgcgaaaaatcgccgaggacgagtcc
tcgacgctcggcgacacctcgacgctggccgatcccggcgtggtcagcgaactggtcgaa
caccgccagaacaagcgccacgtctga

DBGET integrated database retrieval system