KEGG   Rhodopseudomonas palustris BisA53: RPE_0296Help
Entry
RPE_0296          CDS       T00400                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPE_0296
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPE_0296
  Amino acid metabolism
   00310 Lysine degradation
    RPE_0296
Enzymes [BR:rpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPE_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(333307..334614)
Genome map
AA seq 435 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKPGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVSVGALLGQISDGAAAKPAAKEASKAATVAPEVTTGRPDLKTDSTKPINAGPEEM
RPRAETKPDTKTPPADAPLAPSVRRLSAETGVDAATVPGSGKDGRVTKGDMLAAIEKAAS
APTPVSAPAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDM
SHIMALRAQYKDVFEKRHGSKLGFMGFFVRACVQGLRDIPAVNAEIDGTDLIYKNYYHIG
VAVGTDKGLVVPVVRDCDHKSIAQIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYG
SLMSTPILNAPQSGILGMHKIQDRPVVVGGKIEIRPMMYLALSYDHRVIDGKEAVSFLVR
VKESLEDPARLVLDL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatccgcgttccaacgctcggcgaatcggtgaccgaggccaccatcggccgc
tggttcaagaagcccggcgacgccgtggcggtcgacgagccgctggtcgagctggagacc
gacaaggtcaccatcgaggtcccggcgccgtcggccggcacgctcggcgagatcgtcgcc
aaggatggcgaaaccgtttcggtcggcgcgctgctcggccagatttccgatggcgcggcg
gccaagcccgccgccaaggaggcgtcgaaagccgccaccgtggcgccggaagtcaccacc
ggccgtcccgatctcaagaccgactcaaccaagccgatcaatgccggcccggaagaaatg
cggccgagggctgagacgaagccggacaccaagaccccgccggccgacgcgccgctggcg
ccctcggtgcggcggctgtcggccgaaaccggcgtcgatgccgccaccgtgccgggctcc
ggcaaggacggccgcgttaccaagggcgacatgctggcggcgatcgagaaggcggcctcg
gcgccgaccccggtcagcgcccccgccgccgcggtgcaggtccgcgcgccctcgccggcc
gacgacgccgcgcgcgaggagcgcgtgaaaatgacccggctgcgccagaccatcgcgcgc
cggctcaaggacgtacagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatg
agccacatcatggcgctgcgcgcgcagtacaaggacgtgttcgagaagcgccacggctcc
aagctgggcttcatgggcttcttcgtgcgcgcctgcgtgcaggggctgagggacatcccg
gcggtcaacgccgagatcgacggcaccgatttgatctacaagaactactaccacatcggc
gtcgcggtcggcaccgacaagggcctggtggtgccggtggtgcgcgattgcgaccacaag
tcgatcgcccagatcgagaagggcatcgccgatttcggccgccgcgcccgcgacggccag
ctcaagatcgacgagatgcagggcggcaccttcaccatcaccaatggcggcatctacggc
tcgctgatgtcaacgccgatcctgaacgcgccgcagtccggcatcctcggcatgcacaag
atccaggaccgcccggtggtggtcggcggcaagatcgaaatccgtccgatgatgtatctg
gcgctgagctacgatcaccgcgtgatcgacggcaaggaggcggtgagcttcctggtccgg
gtcaaggaaagcctggaagacccggcgcggctggtgctggatctgtaa

DBGET integrated database retrieval system