KEGG   Rhodopseudomonas palustris BisA53: RPE_0296Help
Entry
RPE_0296          CDS       T00400                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00020  Citrate cycle (TCA cycle)
rpe00310  Lysine degradation
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
rpe01130  Biosynthesis of antibiotics
rpe01200  Carbon metabolism
Module
rpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPE_0296
  Amino acid metabolism
   00310 Lysine degradation
    RPE_0296
Enzymes [BR:rpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPE_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABJ04255
JGI: RPE0296
UniProt: Q07UX9
Position
complement(333307..334614)
Genome map
AA seq 435 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKPGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVSVGALLGQISDGAAAKPAAKEASKAATVAPEVTTGRPDLKTDSTKPINAGPEEM
RPRAETKPDTKTPPADAPLAPSVRRLSAETGVDAATVPGSGKDGRVTKGDMLAAIEKAAS
APTPVSAPAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDM
SHIMALRAQYKDVFEKRHGSKLGFMGFFVRACVQGLRDIPAVNAEIDGTDLIYKNYYHIG
VAVGTDKGLVVPVVRDCDHKSIAQIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYG
SLMSTPILNAPQSGILGMHKIQDRPVVVGGKIEIRPMMYLALSYDHRVIDGKEAVSFLVR
VKESLEDPARLVLDL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatccgcgttccaacgctcggcgaatcggtgaccgaggccaccatcggccgc
tggttcaagaagcccggcgacgccgtggcggtcgacgagccgctggtcgagctggagacc
gacaaggtcaccatcgaggtcccggcgccgtcggccggcacgctcggcgagatcgtcgcc
aaggatggcgaaaccgtttcggtcggcgcgctgctcggccagatttccgatggcgcggcg
gccaagcccgccgccaaggaggcgtcgaaagccgccaccgtggcgccggaagtcaccacc
ggccgtcccgatctcaagaccgactcaaccaagccgatcaatgccggcccggaagaaatg
cggccgagggctgagacgaagccggacaccaagaccccgccggccgacgcgccgctggcg
ccctcggtgcggcggctgtcggccgaaaccggcgtcgatgccgccaccgtgccgggctcc
ggcaaggacggccgcgttaccaagggcgacatgctggcggcgatcgagaaggcggcctcg
gcgccgaccccggtcagcgcccccgccgccgcggtgcaggtccgcgcgccctcgccggcc
gacgacgccgcgcgcgaggagcgcgtgaaaatgacccggctgcgccagaccatcgcgcgc
cggctcaaggacgtacagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatg
agccacatcatggcgctgcgcgcgcagtacaaggacgtgttcgagaagcgccacggctcc
aagctgggcttcatgggcttcttcgtgcgcgcctgcgtgcaggggctgagggacatcccg
gcggtcaacgccgagatcgacggcaccgatttgatctacaagaactactaccacatcggc
gtcgcggtcggcaccgacaagggcctggtggtgccggtggtgcgcgattgcgaccacaag
tcgatcgcccagatcgagaagggcatcgccgatttcggccgccgcgcccgcgacggccag
ctcaagatcgacgagatgcagggcggcaccttcaccatcaccaatggcggcatctacggc
tcgctgatgtcaacgccgatcctgaacgcgccgcagtccggcatcctcggcatgcacaag
atccaggaccgcccggtggtggtcggcggcaagatcgaaatccgtccgatgatgtatctg
gcgctgagctacgatcaccgcgtgatcgacggcaaggaggcggtgagcttcctggtccgg
gtcaaggaaagcctggaagacccggcgcggctggtgctggatctgtaa

DBGET integrated database retrieval system