KEGG   Rhodopseudomonas palustris BisA53: RPE_0303Help
Entry
RPE_0303          CDS       T00400                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rpe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(343166..343822)
Genome map
AA seq 218 aa AA seqDB search
MFCRSLVLTAAVSLAVTGHGAAESAPADVRPVKLVALGDSLTAGYGLPASGAFPVKLQKA
LKEKGIAVEIGNAGVSGDTSSGGLARLDWSIAKDTDGVILELGANDALRGIDPQVTRKAL
EEILKKMKARNIPVLLCGMYAPPNYGQEYAAKFNAIYPDLAKQYGVPLYPFFLDGVATVA
RLTQPDGLHPTAEGIDTIVSNILPTVEAFVRSINGQRS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttttgccgcagcctggtgctgacggcggcggtgagcttggcggtaacggggcacggc
gcggccgagagcgcgccggcagatgtgcggccggtcaagctggtggcgctgggcgattcg
ctgaccgccggctacggcctgccggcctccggggcgtttccggtgaaactgcaaaaagcc
ctgaaagagaaagggatagcggtcgagatcggcaatgccggggtgtccggcgatacctcc
tcgggcgggctcgcccggctcgactggtcgatcgccaaagacaccgacggcgtgatcctc
gaactcggcgccaatgacgcgctgcgcgggatcgatccgcaggtcacccgcaaggcgctg
gaagagatcctgaagaagatgaaggcgcgcaacattccggtgctgttgtgcggcatgtat
gcgccgccgaattacggccaggagtatgccgccaaattcaacgccatctatccggatctc
gccaagcaatatggcgtgccgctgtatccgttcttcctcgacggcgtcgccacggtggcg
cggctgacccagcccgacgggctgcatccgaccgcggagggcatcgacaccatcgtcagc
aacatcctgcccacggtcgaggcattcgtgcggtcgatcaacgggcaaaggagctga

DBGET integrated database retrieval system