KEGG   Rhodopseudomonas palustris BisA53: RPE_0454Help
Entry
RPE_0454          CDS       T00400                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPE_0454
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPE_0454
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPE_0454
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPE_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
496607..497821
Genome map
AA seq 404 aa AA seqDB search
MNSPLPNSYRSGPDDRGHFGLFGGRFVAETLMPLILDLEKAYAEAKIDPAFRAEMDGHLK
HYVGRPSPLYFAERLTDHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKPRIIAE
TGAGMHGVATATLCAKFGLKCVVFMGAVDIDRQEPNVLRMKALGAEVRPVTSGAATLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGHEVREQIMQLEGRLPDSLIA
CIGGGSNAMGLFHPFLDDPEVAIYGVEAAGHGLSKLHAASIAGGKPGVLHGNRTYLLMDG
DGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVLNMSGRGDKDLASVAEHLGGQF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacctctgcccaattcctatcgatccggccccgacgaccgcggccatttcggc
ctgttcggcggccgcttcgtcgccgaaacgctgatgccgctgatcctcgatctggaaaag
gcctatgccgaggccaaaatagacccggcgtttcgcgccgagatggatggccatctgaag
cactatgtcggccggccgtcgccgctgtatttcgccgagcggctgaccgatcacttcggc
ggcgccaaaatctatttcaagcgcgaggacctcaaccacaccggcgcgcacaaggtgaac
aacgtgctcggccagatcatgctggccaggcggatgggcaagccgcggatcatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgctgtgcgccaagttcgggctgaaa
tgcgtggtgttcatgggcgcggtcgatatcgatcgccaggagcccaacgtgctgcggatg
aaggcgctcggcgccgaggtccgccccgtcacctccggcgcggcgacgctgaaggacgcc
atgaacgaggcgctgcgcgactgggtcaccaacgtccacgacaccttctactgcatcggc
accgtggcggggccgcatccctatccgatgatggtgcgggatttccagtcggtgatcggt
cacgaggtgcgcgagcagatcatgcagctggaaggccggctgccggattcgctgatcgcc
tgcatcggcggaggctccaacgccatggggctgttccatccgtttctcgacgaccccgag
gttgccatctacggcgtcgaagccgccggtcacggcctcagcaagctgcacgcggcctcg
atcgccggcggcaagcccggcgtgctgcacggcaaccgcacctatctgttgatggacggc
gacggccagatccaggaagcgcattcgatctccgccggcctcgactatcccggcatcggc
cccgaacacgcctggctgcacgacgtcggtcgggtcaatttcctgtccgccaccgacacc
gaggcgctcgacgccttcaagctgtgctgccggctggagggcatcatcccggcgctggag
ccctcgcacgcgctcgccaaggtcgccgatctcgcgccaaaactgccgaaggatcatctg
atggtgctgaacatgtcgggccgcggcgacaaggatctcgcctccgtcgccgagcatctc
ggagggcagttctga

DBGET integrated database retrieval system