KEGG   Rhodopseudomonas palustris BisA53: RPE_0454Help
Entry
RPE_0454          CDS       T00400                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00260  Glycine, serine and threonine metabolism
rpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01130  Biosynthesis of antibiotics
rpe01230  Biosynthesis of amino acids
Module
rpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPE_0454
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPE_0454
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPE_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ04413
JGI: RPE0454
UniProt: Q07UH1
Position
496607..497821
Genome map
AA seq 404 aa AA seqDB search
MNSPLPNSYRSGPDDRGHFGLFGGRFVAETLMPLILDLEKAYAEAKIDPAFRAEMDGHLK
HYVGRPSPLYFAERLTDHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKPRIIAE
TGAGMHGVATATLCAKFGLKCVVFMGAVDIDRQEPNVLRMKALGAEVRPVTSGAATLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGHEVREQIMQLEGRLPDSLIA
CIGGGSNAMGLFHPFLDDPEVAIYGVEAAGHGLSKLHAASIAGGKPGVLHGNRTYLLMDG
DGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVLNMSGRGDKDLASVAEHLGGQF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacctctgcccaattcctatcgatccggccccgacgaccgcggccatttcggc
ctgttcggcggccgcttcgtcgccgaaacgctgatgccgctgatcctcgatctggaaaag
gcctatgccgaggccaaaatagacccggcgtttcgcgccgagatggatggccatctgaag
cactatgtcggccggccgtcgccgctgtatttcgccgagcggctgaccgatcacttcggc
ggcgccaaaatctatttcaagcgcgaggacctcaaccacaccggcgcgcacaaggtgaac
aacgtgctcggccagatcatgctggccaggcggatgggcaagccgcggatcatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgctgtgcgccaagttcgggctgaaa
tgcgtggtgttcatgggcgcggtcgatatcgatcgccaggagcccaacgtgctgcggatg
aaggcgctcggcgccgaggtccgccccgtcacctccggcgcggcgacgctgaaggacgcc
atgaacgaggcgctgcgcgactgggtcaccaacgtccacgacaccttctactgcatcggc
accgtggcggggccgcatccctatccgatgatggtgcgggatttccagtcggtgatcggt
cacgaggtgcgcgagcagatcatgcagctggaaggccggctgccggattcgctgatcgcc
tgcatcggcggaggctccaacgccatggggctgttccatccgtttctcgacgaccccgag
gttgccatctacggcgtcgaagccgccggtcacggcctcagcaagctgcacgcggcctcg
atcgccggcggcaagcccggcgtgctgcacggcaaccgcacctatctgttgatggacggc
gacggccagatccaggaagcgcattcgatctccgccggcctcgactatcccggcatcggc
cccgaacacgcctggctgcacgacgtcggtcgggtcaatttcctgtccgccaccgacacc
gaggcgctcgacgccttcaagctgtgctgccggctggagggcatcatcccggcgctggag
ccctcgcacgcgctcgccaaggtcgccgatctcgcgccaaaactgccgaaggatcatctg
atggtgctgaacatgtcgggccgcggcgacaaggatctcgcctccgtcgccgagcatctc
ggagggcagttctga

DBGET integrated database retrieval system