KEGG   Rhodopseudomonas palustris BisA53: RPE_0454Help
Entry
RPE_0454          CDS       T00400                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rpe00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rpe00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
496607..497821
Genome map
AA seq 404 aa AA seqDB search
MNSPLPNSYRSGPDDRGHFGLFGGRFVAETLMPLILDLEKAYAEAKIDPAFRAEMDGHLK
HYVGRPSPLYFAERLTDHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKPRIIAE
TGAGMHGVATATLCAKFGLKCVVFMGAVDIDRQEPNVLRMKALGAEVRPVTSGAATLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGHEVREQIMQLEGRLPDSLIA
CIGGGSNAMGLFHPFLDDPEVAIYGVEAAGHGLSKLHAASIAGGKPGVLHGNRTYLLMDG
DGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVLNMSGRGDKDLASVAEHLGGQF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacctctgcccaattcctatcgatccggccccgacgaccgcggccatttcggc
ctgttcggcggccgcttcgtcgccgaaacgctgatgccgctgatcctcgatctggaaaag
gcctatgccgaggccaaaatagacccggcgtttcgcgccgagatggatggccatctgaag
cactatgtcggccggccgtcgccgctgtatttcgccgagcggctgaccgatcacttcggc
ggcgccaaaatctatttcaagcgcgaggacctcaaccacaccggcgcgcacaaggtgaac
aacgtgctcggccagatcatgctggccaggcggatgggcaagccgcggatcatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgctgtgcgccaagttcgggctgaaa
tgcgtggtgttcatgggcgcggtcgatatcgatcgccaggagcccaacgtgctgcggatg
aaggcgctcggcgccgaggtccgccccgtcacctccggcgcggcgacgctgaaggacgcc
atgaacgaggcgctgcgcgactgggtcaccaacgtccacgacaccttctactgcatcggc
accgtggcggggccgcatccctatccgatgatggtgcgggatttccagtcggtgatcggt
cacgaggtgcgcgagcagatcatgcagctggaaggccggctgccggattcgctgatcgcc
tgcatcggcggaggctccaacgccatggggctgttccatccgtttctcgacgaccccgag
gttgccatctacggcgtcgaagccgccggtcacggcctcagcaagctgcacgcggcctcg
atcgccggcggcaagcccggcgtgctgcacggcaaccgcacctatctgttgatggacggc
gacggccagatccaggaagcgcattcgatctccgccggcctcgactatcccggcatcggc
cccgaacacgcctggctgcacgacgtcggtcgggtcaatttcctgtccgccaccgacacc
gaggcgctcgacgccttcaagctgtgctgccggctggagggcatcatcccggcgctggag
ccctcgcacgcgctcgccaaggtcgccgatctcgcgccaaaactgccgaaggatcatctg
atggtgctgaacatgtcgggccgcggcgacaaggatctcgcctccgtcgccgagcatctc
ggagggcagttctga

DBGET integrated database retrieval system