KEGG   Rhodopseudomonas palustris BisA53: RPE_0455Help
Entry
RPE_0455          CDS       T00400                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPE_0455
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPE_0455
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPE_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
497821..498657
Genome map
AA seq 278 aa AA seqDB search
MTTRLDSRFADLKKQGRAAFVTFLMAGDPDLDTSLKLLQALPKAGADIIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLQKTLELVRAFRKADDATPLVLMGYYNPIYIYGVEPFLIDAK
AAGVDGLIIVDLPPEEDAELCLPAIKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSV
TGITGAASADASAVSAAVTRIKRHTPLPVCVGFGIRTPEGARDIARHADGAVVGSALVDV
LSRSLDAEGRATAATVPAVADLVASLARGVHGAAQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgtctcgacagccgtttcgccgacctcaagaaacaaggccgcgccgccttc
gtcaccttcctgatggccggcgaccccgacctcgacacctcgctgaagctgctgcaggcg
ctgcccaaggccggcgccgacatcatcgagatcggcatgccgttcaccgatccgatggcc
gacggcccggcgatccaggccgccggcctgcgcgcgctgaaggccggcacgactctgcag
aagacgctggagctggtccgcgccttccggaaagccgacgacgccacgccgctggtgctg
atgggctactacaatccgatctacatctacggcgtcgagccattcctgatcgatgccaag
gccgccggcgtcgacgggctgatcatcgtcgatctgccgccggaggaagacgccgaattg
tgcctgccggcgatcaaggccgggctgaatttcatccgcctcgccacccccaccaccgat
gacaagcggctgccggcggtgctcgcgaacacctcgggctttgtctattacgtttcggtg
accggcatcaccggcgctgccagcgccgatgccagcgcggtcagcgccgcggtgacaagg
atcaagcgccacacgccgttgccggtctgcgtcggcttcggcatccgcacgccggagggc
gcgcgcgatatcgcccgccacgccgacggcgcggtggtcggctcggcgctggtcgatgtg
ctcagccgcagcctcgacgccgagggccgcgccacggccgccacggtgccggcggtggcc
gatctggtggcgtcgctggcgcgcggcgtccatggcgccgcgcaggcggcggaatag

DBGET integrated database retrieval system