KEGG   Rhodopseudomonas palustris BisA53: RPE_0471Help
Entry
RPE_0471          CDS       T00400                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rpe03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
520601..521482
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRLGLQPAMEGARFDTVALRRADLRFPFQPDFTDRLTGQTVTGLSRRAKYL
LADLSSGDALLMHLGMSGSFRVIEPGGEATPGDFHHPRSEDRSHDHVVFSMSSGKTVVFN
DPRRFGYMKLFRRAAIEDEPFLKGLGPEPLGNAFDASMLARACAGKKTSLKAALLDQRVV
AGLGNIYVCEALFRAHLSPKRLAATLATKAGGPTERAEKLVEAIRTVLHEAIQAGGSSLR
DHRQTSGELGYFQHSFAVYDRESEPCRTKGCGGVVKRFVQNGRSTFCCPKCQK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcccgaagtggaaaccgtgcggctgggcttgcagccggcgatggagggc
gcccgcttcgacacggtggccttgcgccgggccgacctgcggttcccgttccagcccgac
ttcaccgaccggctgaccggccagaccgtgaccgggctcagccgccgcgccaaatatctc
ttggccgacctctccagcggcgacgcgctgttgatgcatctcggcatgtccggctcgttc
cgggtgatcgagccgggcggcgaggcgacgccgggcgacttccaccacccccgctccgag
gaccgcagccacgaccacgtggtgttttcgatgtcgtcgggcaagacggtggtgttcaac
gatccgcgccggttcggctacatgaagctgtttcgccgcgccgcgatcgaggacgagccg
tttctcaaagggctggggccggagccgctcggcaacgccttcgatgcttcgatgctggcg
agggcatgcgccggcaaaaaaacctcgctgaaggcggcgctgttggaccagcgcgtggtc
gcggggctcggcaacatctatgtctgcgaggcgctgtttcgcgcgcatctttcgcccaaa
cgcctcgccgcgacgctcgccaccaaagctggcgggccgaccgagcgcgccgaaaaactg
gtcgaagcgatccgcaccgtgctgcacgaggcgatccaagccggcggctcgtcgctgcgc
gaccaccgccagacctcgggcgaactcggctatttccagcattcgttcgcggtctacgac
cgcgaaagcgaaccgtgccggaccaagggctgcggcggtgtggtgaagcgctttgtgcag
aacgggcgatcgacgttctgctgcccgaagtgccagaagtga

DBGET integrated database retrieval system