KEGG   Rhodopseudomonas palustris BisA53: RPE_0511Help
Entry
RPE_0511          CDS       T00400                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:rpe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rpe00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpe00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rpe00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
558963..559376
Genome map
AA seq 137 aa AA seqDB search
MNAEHSQGPGKNTMRTPLGKVRKLGPARSGTSDFWQQRITGVAMTLLILPVIIIIMMLLG
RNQAGAAQILGSPLIALTMILFIVASAIHMKIGMQVVIEDYIQNEKLKLVTIMANNFFSI
AVALAPIFAIIKLSSGV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgaacattcccaggggccggggaaaaacaccatgcgcacgccgctcggcaag
gtgcgcaaattgggtcccgcccgctccggcaccagcgatttctggcagcagcgcatcacc
ggcgtggcgatgacgctgctgatcctgcccgtcatcatcatcatcatgatgctactcggc
cgcaaccaggccggcgcggcgcagatcctcggctcgcccttgatcgcgctgaccatgatc
ctgttcatcgtcgccagcgcgatccacatgaagatcggcatgcaggtggtgatcgaggac
tacattcagaacgaaaagctgaagctggtcaccatcatggccaacaatttcttctcgatc
gcggtggcgctcgcgcccatcttcgccatcatcaaactgtcctccggagtataa

DBGET integrated database retrieval system