KEGG   Rhodopseudomonas palustris BisA53: RPE_0674Help
Entry
RPE_0674          CDS       T00400                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPE_0674
   01212 Fatty acid metabolism
    RPE_0674
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPE_0674
   00650 Butanoate metabolism
    RPE_0674
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_0674
   01040 Biosynthesis of unsaturated fatty acids
    RPE_0674
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPE_0674
   00310 Lysine degradation
    RPE_0674
   00380 Tryptophan metabolism
    RPE_0674
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPE_0674
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPE_0674
   00281 Geraniol degradation
    RPE_0674
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RPE_0674
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RPE_0674
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPE_0674
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RPE_0674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
745281..747497
Genome map
AA seq 738 aa AA seqDB search
MTFKIFKLETDADGIALVTWDLPGKSMNVLDAQTIEELGAIVEQTTADAAVKGVVITSAK
EAFCAGADLSMLEGMNKTFAQIKKDKGEEAAQQMLFEESRKLSQILRKIETSGKPWVAAI
NGLALGGGFEVTLACHHRVAADNPKTRLGLPEIKVGLFPGGGGTQRIPRIVQPQDALQIL
LKGDQVKLDKAKTWKLVDAIVPAAELITTAKAWIKGGGKAVAPWDEKGFKLPGGQVFSKQ
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQVPMDVALRIESRYFAHVVQTKEAAA
MIRSLFLSMQELNKGARRPQGVPPTKVKKLAIIGAGFMGASVGYVSAKAGIDVVLIDRDQ
ESADKGKAHCKSVIDGLIAKGRAKDADRDALMARITATPDFDALKDCDLVIEAVFEDRKV
KAEIYAKAQPLLKEGAIFASNTSTLPINSLAEEFKDQSKFIGIHFFSPVEKMMLVEVILG
NNTGDVALATALDYTRQINKTPIVVNDSRGFFANRCVLRFTAEGLEMLMEGVPAPMIETT
AKMAGMPVGPLSLADEVALDLVLKIMKATEADLGEQAVDQQQKKLMVELVEKQGRFGRKN
AKGFYDYPEKGKGQKALWSGIAALQPKHLDPDTIDIEELKQRFLVVQAVEAARTVEDNVI
VDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHRLEAKYGSRFTPPKLLEDMA
KTGETFYQRFAPKKQAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaagatcttcaagctcgagaccgacgctgacggcattgcgctggtcacctgg
gacctgcccggcaagtcgatgaacgtgctggacgcccagaccatcgaagaactcggcgcc
atcgtcgagcagaccaccgccgacgccgcggtgaagggcgtggtgatcacctccgccaag
gaggcgttctgcgccggcgccgatctgtcgatgctggaaggcatgaacaagactttcgcg
cagatcaagaaggacaagggcgaagaagccgcccagcagatgctgttcgaggagagccgc
aagctgtcgcagatcctgcgcaagatcgaaaccagcggcaagccgtgggtcgccgcgatc
aacggcctggcgctcggcggcggttttgaagtgacgctggcctgtcaccatcgcgtcgcg
gccgacaatcccaaaacccggctcggcctgccggagatcaaggtcggcctgttcccgggc
ggcggcggcacccagcggattccgcgcatcgtgcagccgcaggacgcgctgcagatcctg
ttgaagggcgatcaggtcaagctcgacaaggccaagacctggaagctggtcgacgccatc
gtgccggcggccgagctgatcacgaccgcgaaggcctggatcaagggcggcggcaaggcc
gtcgcgccctgggacgagaagggcttcaagctgcccggcggtcaggtgttctccaagcag
ggcatgatgatgttcccggccggcaacgccatctatcgccgcgagacctacgacaactat
ccggccgcgcgcgccatcatgagctgcgtctatgaaggcctgcaggtgccgatggacgtg
gcgctgcgcatcgagtcgcgctacttcgcccatgtcgtgcagaccaaggaagccgcggcg
atgatccgcagcctgttcctgtcgatgcaggagctcaacaagggcgcgcgccgtccgcag
ggcgtgccgccgaccaaggtcaagaagctcgccatcatcggcgccggcttcatgggcgcc
agcgtcggctacgtctcggccaaggccggcatcgacgtggtgctgatcgaccgcgaccag
gagagcgccgacaagggcaaggcgcattgcaaatcggtgatcgacgggctgatcgcaaaa
ggccgcgccaaggacgccgaccgcgacgcgctgatggcgcgcatcacggcgacgccggat
ttcgacgcgctgaaggattgcgatctcgtcatcgaggcggttttcgaggatcgcaaggtc
aaggccgagatctacgccaaggcgcagcctctgttgaaggaaggcgcgatcttcgcctcc
aacacctcgacgctgccgatcaattcgttggccgaggagttcaaggaccagtcgaaattc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtggaagtgattctgggc
aacaacaccggcgacgtcgcactcgccaccgcgctcgactacacccgccagatcaacaag
accccgatcgtggtcaacgactctcgcggcttcttcgccaaccgctgcgtgctgcgcttc
accgccgaaggccttgagatgctgatggaaggcgtgcctgcgccgatgatcgagaccacc
gcgaagatggccggcatgccggtcggtccgttgtcgctggccgatgaagtcgcgctcgac
ctggtgttgaagatcatgaaggccaccgaagccgatctcggcgaacaggcggtcgatcag
cagcagaagaagctgatggtcgaactggtcgaaaagcagggccgcttcggccgcaagaac
gccaagggcttttacgactatcccgagaagggcaagggccagaaggcgctgtggagcggc
atcgcggcgctgcagccaaaacatctcgatcccgacaccatcgatatcgaagagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgcaccgtcgaggacaacgtcatc
gtcgatccgcgcgaggccgacgtcggctcgatcctcggcttcggcttcgcgcccttcacc
ggcggcacgctgagctatatcgacttcatgggcaccaaggagttcgtggcgctgtgccac
agactggaagccaaatacggctcccgcttcaccccgccgaagctcctcgaagacatggcc
aagaccggcgagaccttctaccagcgctttgccccgaagaagcaggcggcggcgtaa

DBGET integrated database retrieval system