KEGG   Rhodopseudomonas palustris BisA53: RPE_0686Help
Entry
RPE_0686          CDS       T00400                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RPE_0686
Enzymes [BR:rpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RPE_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
764735..765682
Genome map
AA seq 315 aa AA seqDB search
MTLVSIPANPVPEDAITGTLKTPDGAELRFARWLPPAGRKGTVCVFTGRGEFIEKYFETV
RDLRDRGFAVAMIDWRGQGHSSRRLKDPRKGYVRDFSDYETDVETFVREVVLPDCPPPHF
ALAHSMGGAVMLRVAHSGKRWFDRMVLSAPMIDLPGRATSLPVRLLLRTMRLTGSGGNYV
PGGNDQLTGTGPFAGNQLTSDPVRYARNAAILVEDATVGIASPTIAWADTAFRAMHGFKA
ANYPEKIHQPLLMIAAGMDTVVSTPAIEEFAYHLRAGTHLVVAGAKHEILQEQDRYRSQF
WAAFDAFVPGTPLFK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgtctcgattcccgccaatccggtcccggaagacgctatcaccggcaccttg
aaaactcccgacggcgccgaattgcgcttcgcgcgctggctgccgccggccggccgcaag
ggcacggtctgcgtcttcaccgggcgcggcgaattcatcgagaagtacttcgagacggtg
cgggatttgcgcgaccgcggctttgcggtggcgatgatcgactggcgcggccagggccat
tcgtcgcgacggctgaaggacccgcgcaagggctacgtccgcgacttctccgactacgag
accgacgtcgagaccttcgtccgcgaagtggtgctgccggattgcccgccgccgcatttc
gcgctggcgcattcgatgggcggggcggtgatgctgcgggtggcgcattccggcaagcgc
tggttcgaccgcatggtgttgtcggcgccgatgatcgacctgcccgggcgcgccacctcg
ctgccggtgcggctgttgctgcggaccatgcggctgaccggctcgggcggcaactacgtc
cccggcggcaacgaccagctcaccggcaccgggccgttcgccggcaaccagctcaccagc
gatccggtgcgctacgcccgcaacgccgcgatcctggtcgaggacgccacggtgggaatc
gcctcgccgaccatcgcctgggccgacaccgcgttccgggcgatgcacggcttcaaggcg
gcaaactatccggaaaaaatccatcagccgctgttgatgatcgccgcaggcatggacacc
gtcgtctcgacgccggcgatcgaggagttcgcctatcatctgcgcgccggcacgcatctg
gtggtcgccggcgccaagcacgagatcctgcaggagcaggaccgctaccgcagccagttc
tgggcggcgttcgacgccttcgtgccgggcaccccgctgttcaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system