KEGG   Rhodopseudomonas palustris BisA53: RPE_0687Help
Entry
RPE_0687          CDS       T00400                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00040  Pentose and glucuronate interconversions
rpe00052  Galactose metabolism
rpe00500  Starch and sucrose metabolism
rpe00520  Amino sugar and nucleotide sugar metabolism
rpe01100  Metabolic pathways
rpe01130  Biosynthesis of antibiotics
Module
rpe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPE_0687
   00052 Galactose metabolism
    RPE_0687
   00500 Starch and sucrose metabolism
    RPE_0687
   00520 Amino sugar and nucleotide sugar metabolism
    RPE_0687
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPE_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABJ04645
JGI: RPE0687
UniProt: Q07TT9
Position
765855..766730
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVVDEAREAGIEHFIFVTGRNK
GVIEDHFDRMYELDATLAARGKKAEQAVLEQFQPAAGAMSFTRQQAPLGLGHAVWCARDI
VGNEPFAVVLPDELVLNTPGCLKQMIEAASCLGDKANMIAVEGVPADMTHQYGICGVGQR
NGKMFEVDGMVEKPKPGTAPSNLSITGRYILQPEIFKILETQERGAGGEIQLTDAMIGLS
KSQKFYGIEFEGERHDCGSKAGFLRANIAYGMQRPELRAELRATMKRYLGE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtcttcccggtcgccggcctcggcacccgcgtgctccccgcc
accaaggcgatgccgaaggagatgctgaccatcgtcgaccgcccgctgatccaatatgtg
gtcgacgaggccagggaagccgggatcgagcacttcatcttcgtcaccgggcgcaacaag
ggcgtgatcgaggaccatttcgaccgcatgtacgagctcgacgccaccctggccgcgcgc
ggcaagaaggccgagcaggcggtgctggagcaattccagcccgccgccggggcgatgagc
ttcacccggcagcaggcgccgctcgggctcggccacgcggtgtggtgcgcccgcgacatc
gtcggcaatgagccgttcgcggtggtgctgccggacgagctggtgctgaatacgccgggc
tgcctcaagcagatgatcgaggccgcttcatgcctcggcgacaaggccaatatgatcgcg
gtcgagggcgtgccggccgacatgacccaccaatacggcatctgcggcgtgggccagcgc
aatggcaagatgttcgaggtcgacggcatggtcgaaaagccgaagcccggcaccgcgccg
tcgaatctctcgatcaccggccgctacatcctgcagccggaaatcttcaagatcctggag
acgcaagagcgtggcgccggcggcgagatccagctcaccgacgccatgatcgggctgtcg
aagtcgcaaaaattctacggcatcgaattcgagggcgagcgccacgattgcggctccaag
gccggcttcctgcgcgccaacatcgcctatgggatgcagcggccggagctgcgcgccgag
ttgcgcgccaccatgaagcgctacctcggagaatag

DBGET integrated database retrieval system