KEGG   Rhodopseudomonas palustris BisA53: RPE_0769Help
Entry
RPE_0769          CDS       T00400                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPE_0769
   01230 Biosynthesis of amino acids
    RPE_0769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_0769
   00030 Pentose phosphate pathway
    RPE_0769
   00051 Fructose and mannose metabolism
    RPE_0769
   00052 Galactose metabolism
    RPE_0769
  Energy metabolism
   00680 Methane metabolism
    RPE_0769
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPE_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
855398..856369
Genome map
AA seq 323 aa AA seqDB search
MAYILTVTPSPALDATTSVPTLKPFSKLRCGPMLRHPGGGGVNVARVIQRLGGDVLAVYP
AGGAIGQLVRQLLDAEGVNSLVIPVAPETREDFTVFEDSTRKQYRFVLPGEKLTVSEWQP
LIDAVSKATPAPAFVVASGSLPPGVPADFYARVVRAGRARGAKVIVDTSHEALDAALDAG
GIYLIKPSMSEFRTLTGVADDADQPTLIAAGRAMIARGAVELVALSMGPSGALLISRDHA
WHAEGMTLDPASVVGAGDSLVAAMVWRLAEGASLEDALRFGVAAGSAALLNPGTSLCQRQ
DIDKFVPQIRLRDVGAMSSVAIG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttggcctacattctcaccgtgacgccgagtccggcgctggacgccacgacctcggtcccc
accctaaaaccgttctccaagctgcgttgcggcccgatgctgcgccatcccggcggcggc
ggcgtcaacgtcgcccgcgtgatccagcggctcggtggcgacgtgctggcggtctatccc
gccggcggcgcgatcggccaattggtgcggcaactgctcgacgccgagggcgtcaacagc
ctggtgattccggttgcaccggaaacccgggaagatttcacggtgttcgaggactcgacg
cgaaaacaatatcgcttcgtgctgccgggcgagaaattgaccgtgtcggaatggcagccg
ctgatcgatgcggtgagcaaggccaccccggcgccggcctttgtggtggcgagcggcagc
ctgccgccgggcgtgccggcggacttctatgcccgcgtggtgcgcgctggccgggcgcgc
ggcgccaaggtgatcgtcgacacctcgcacgaggcgctcgatgccgcgctagacgccggc
ggcatctatctgatcaagcccagcatgagcgaattccggaccctgaccggcgtggccgac
gacgccgaccagcccaccttgatcgcggcggggcgcgcgatgatcgcgcgcggcgcggtc
gaactggtggcgctcagcatggggccgagcggggcgctgttgatttcacgcgaccatgcc
tggcacgccgaaggcatgacgctcgatccggccagcgtagtcggggccggcgacagcctg
gtggcggcgatggtgtggcggctggccgagggcgcgagcctcgaggacgcgttgcgcttc
ggcgtcgcggcgggctcggcggcgctgctcaaccccggcacctcgctgtgccagcggcag
gacatcgacaagttcgtgccgcagatccgcctgcgcgacgtcggcgcgatgagctcggtg
gcgatcggttga

DBGET integrated database retrieval system