KEGG   Rhodopseudomonas palustris BisA53: RPE_0796Help
Entry
RPE_0796          CDS       T00400                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(886564..887166)
Genome map
AA seq 200 aa AA seqDB search
MTIHARIAAPSQTKPSPEEVEAAFRTLIRWAGDDPDRAGLKETPARAARAFREYFAGYEQ
DPLAILNKTFDETGGYEEMVVLRGIPFESHCEHHLAPIIGQAWVAYVPSGRVVGLSKLAR
VVDAYAKRLQIQERMTSEIAFAVQDVLKPQGVGVVIKATHHCMSSRGVHKVGADMVTSCM
LGCFRDNALTRQEFLAIANQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatccacgcccggattgctgcacccagccagaccaagccctcgcccgaggaagtc
gaagccgcgtttcgcaccctcattcgctgggccggcgacgatccggaccgtgccggcctc
aaggaaaccccggcgcgcgccgcgcgtgcgttccgcgagtatttcgccggctatgaacag
gacccgctggcgatcctgaacaagactttcgatgagaccggcggctatgaggaaatggtg
gtgctgcgtggcatcccgttcgagagccattgcgagcatcatttggcgccgatcatcggt
caggcgtgggtggcttacgtgcccagcgggcgggtggtcgggctgtcaaaactcgcgcgc
gtggtggacgcctacgccaagcggctgcagatccaggaacgcatgacctcggagatcgcc
ttcgcggtccaggacgtgctgaagccgcagggcgtcggcgtggtgatcaaggcgacgcat
cactgcatgtccagccgcggcgtgcacaaggtcggcgccgacatggtgaccagctgcatg
ctcggctgcttccgcgacaacgccctcacccgtcaggaatttttggccatcgccaaccaa
tga

DBGET integrated database retrieval system