KEGG   Rhodopseudomonas palustris BisA53: RPE_0871Help
Entry
RPE_0871          CDS       T00400                                 

Gene name
hisG
Definition
ATP phosphoribosyltransferase (EC:2.4.2.17)
Orthology
K00765  
ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpe01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rpe00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(971313..972290)
Genome map
AA seq 325 aa AA seqDB search
MSQPFVLAVPSKGRLQENAEAFFARAGLTLAKSGGARDYRGTIVGLDNVEVAYLSASEIA
ANLARGSVHFGVTGEDLIRESIVDADKRVALIDGLGFGRADVVVAVPQAWIDVRTMADLD
DVTTGFRAQHNRRMRVATKYINLTRGFFASHGVVDYRIVESAGATEGAPAVGTAELIVDI
TTTGATLAANGLRVLDDGVMLRSQANLVASREADWTDATRETARIILDHIASRARAGKFK
EVRTRFSGCNDALLAEAHAKFGVVSPFGGPTSSGMLTLHCPPAQLYGLSSFLRGHGAETV
SVVSLDYVMDRENPLFAKLEAFLRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcctttcgttctcgccgttccctcaaaaggccggctgcaggaaaacgccgaa
gcctttttcgcccgcgccgggctgacgctggccaagtccggcggcgcccgtgactatcgc
ggcaccattgtcggcctcgacaatgtcgaggtcgcctatctgtcggccagcgaaatcgcc
gccaatctggcgcgcggttcggtgcatttcggcgtcaccggagaagacctgattcgcgag
agcatcgtcgatgccgacaagcgcgtggcgctgatcgacgggctcggcttcggccgcgcc
gacgtcgtggtcgcggtgccgcaggcctggatcgacgtccgcaccatggccgacctcgac
gacgtcaccaccggctttcgcgcccagcacaatcggcggatgcgggtggcgaccaaatac
atcaatttgacgcgcggcttcttcgccagccacggcgtggtcgactaccgcatcgtggaa
agcgccggcgccaccgagggcgcgccagcggtcggcaccgcggagctgatcgtcgacatc
accaccaccggcgcgacgctggcggccaacggcttgagggtgctggacgacggcgtgatg
ctgcggagccaggccaatctggtggcctcgcgcgaggccgactggaccgacgccacgcgg
gagaccgcgcggatcatcctcgaccacatcgcctcgcgcgcccgcgccggcaagttcaag
gaagtccgcacccgcttctcgggctgcaatgacgcgctgctggccgaagcccacgccaaa
ttcggcgtggtgtcgccgttcggcggcccgacctcgtcgggaatgctgacactgcactgc
ccgccagcgcagctctacgggctgtcgagctttctgcgcggccacggcgccgagaccgtc
tcggtggtctcgctggactatgtgatggatcgcgagaacccgctgttcgccaaactcgag
gcgtttctgcggtcataa

DBGET integrated database retrieval system