KEGG   Rhodopseudomonas palustris BisA53: RPE_0871Help
Entry
RPE_0871          CDS       T00400                                 

Gene name
hisG
Definition
ATP phosphoribosyltransferase (EC:2.4.2.17)
Orthology
K00765  
ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPE_0871 (hisG)
  Amino acid metabolism
   00340 Histidine metabolism
    RPE_0871 (hisG)
Enzymes [BR:rpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     RPE_0871 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(971313..972290)
Genome map
AA seq 325 aa AA seqDB search
MSQPFVLAVPSKGRLQENAEAFFARAGLTLAKSGGARDYRGTIVGLDNVEVAYLSASEIA
ANLARGSVHFGVTGEDLIRESIVDADKRVALIDGLGFGRADVVVAVPQAWIDVRTMADLD
DVTTGFRAQHNRRMRVATKYINLTRGFFASHGVVDYRIVESAGATEGAPAVGTAELIVDI
TTTGATLAANGLRVLDDGVMLRSQANLVASREADWTDATRETARIILDHIASRARAGKFK
EVRTRFSGCNDALLAEAHAKFGVVSPFGGPTSSGMLTLHCPPAQLYGLSSFLRGHGAETV
SVVSLDYVMDRENPLFAKLEAFLRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcctttcgttctcgccgttccctcaaaaggccggctgcaggaaaacgccgaa
gcctttttcgcccgcgccgggctgacgctggccaagtccggcggcgcccgtgactatcgc
ggcaccattgtcggcctcgacaatgtcgaggtcgcctatctgtcggccagcgaaatcgcc
gccaatctggcgcgcggttcggtgcatttcggcgtcaccggagaagacctgattcgcgag
agcatcgtcgatgccgacaagcgcgtggcgctgatcgacgggctcggcttcggccgcgcc
gacgtcgtggtcgcggtgccgcaggcctggatcgacgtccgcaccatggccgacctcgac
gacgtcaccaccggctttcgcgcccagcacaatcggcggatgcgggtggcgaccaaatac
atcaatttgacgcgcggcttcttcgccagccacggcgtggtcgactaccgcatcgtggaa
agcgccggcgccaccgagggcgcgccagcggtcggcaccgcggagctgatcgtcgacatc
accaccaccggcgcgacgctggcggccaacggcttgagggtgctggacgacggcgtgatg
ctgcggagccaggccaatctggtggcctcgcgcgaggccgactggaccgacgccacgcgg
gagaccgcgcggatcatcctcgaccacatcgcctcgcgcgcccgcgccggcaagttcaag
gaagtccgcacccgcttctcgggctgcaatgacgcgctgctggccgaagcccacgccaaa
ttcggcgtggtgtcgccgttcggcggcccgacctcgtcgggaatgctgacactgcactgc
ccgccagcgcagctctacgggctgtcgagctttctgcgcggccacggcgccgagaccgtc
tcggtggtctcgctggactatgtgatggatcgcgagaacccgctgttcgccaaactcgag
gcgtttctgcggtcataa

DBGET integrated database retrieval system