KEGG   Rhodopseudomonas palustris BisA53: RPE_1306Help
Entry
RPE_1306          CDS       T00400                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1468463..1469485
Genome map
AA seq 340 aa AA seqDB search
MATVFPFSAIVGQDEMKLALLIAAVDPKVGGVLAFGDRGAGKSTAVRALAALLPKMKVVV
GCRYNCDPSQPEKFCDECKDKAAHGKLKAVQAPVPVVDLPLGATEDRVVGALDLERALAR
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPNDLPSRMEVVRRRDSFETDPEAFLEAWAKEEA
KLRKKITQARDRLPEVTVSNAALERAATLCMTLGTDGLRGELTLMRAARALAALEHAKTV
TDEHLKRIAPSALRHRLRRNPLDDAGSTVRVDRAIAEVFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagttttccccttttccgccatcgtcggccaggacgagatgaagctcgcgctg
ctgatcgcagcggtcgacccgaaagtcggcggcgtgctggcgttcggcgaccgcggcgcc
ggcaagtccaccgcggtgcgcgcgctggcggcgctgctgccgaagatgaaggtcgtggtc
gggtgtcgctacaattgcgatcccagccagcccgaaaaattctgcgacgagtgcaaggac
aaggcggcccacggcaagctgaaggcggtgcaggccccggtgccggtggtcgatctgccg
ctcggcgccaccgaagaccgcgtggtcggcgcactcgatctcgaacgcgcgctggcgcgc
ggcgagaaggcgttcgagccgggcctgttggcccgcgctcatcgcggcttcctctacatc
gacgaagccaacctcctcgaagaccatctggtcgatctcttgctcgacgtcgccgcctcc
ggcgagaacgtggtcgagcgcgaaggcctctcgatccgccatccggcgcgcttcgtgctg
gtcggcaccggcaacccggaagagggcgagctgcgtccgcaattgctcgatcgtttcggc
atgtcggtcgaggtcaagacgccgaacgacctgccgagccgcatggaagtggtgcgccgc
cgcgactcgttcgagaccgatccggaggcgtttctggaagcctgggccaaggaagaagcc
aagctgcgcaagaagatcacccaggcgcgcgatcggctgcccgaagtcacggtgtcgaac
gccgcgctggagcgcgccgcgacgctgtgcatgacgctcggtaccgacggcctgcgcggc
gaactgaccttgatgcgcgccgcccgcgccctggcggcgctggagcacgccaagaccgtc
accgacgaacatctcaagcgcattgccccctccgcgctgcggcacaggctgcggcgtaac
ccgctcgacgacgccggctccaccgtccgcgtcgatcgcgccatcgccgaagtgttcgga
tga

DBGET integrated database retrieval system