KEGG   Rhodopseudomonas palustris BisA53: RPE_1307Help
Entry
RPE_1307          CDS       T00400                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPE_1307 (bchD)
Enzymes [BR:rpe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPE_1307 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1469482..1471257
Genome map
AA seq 591 aa AA seqDB search
MNLAVAWSDAATAAQLFAVDPVGTGVLLRSRAGPVRDRWLAMLRAALPPTDAHKHLPLHI
AEGRLLGGLDLSATLISGRPVAERGLLAEADGGVLMLAMAERMPSSTTVHVTAAMDSHET
LIERDGLSLRMPARFGVVALDEGLEDEVAPAGLCDRLAFHLELDRFSFRDTEEFDIAAGD
IEVARSRLPSIRATDEQIEALVNAAAAMGIVSLRTPLLAIRVARAAAALSGHTEIDQEDI
AIAARLVLAPRALYFPQPEQEPDQAEPPPPEPPPEDNSEDNKDQDEQQIPDIDRALDEII
LAAAKAAIPPDVLASLRASSGRSRSRSSGKAGELQKSNKRGRPTGTLRGELRAGAKLSVI
ETLRSAAPWQPLRRREAAAAGRDTAQPQILIRKDDFRIARFKQRTETTTIFVVDASGSAA
LHRLAEAKGAVELLLADCYVRRDQVAMIAFRGEIAEILLPPTRSLARAKRSLAGLPGGGG
TPLAAGLDAAFALADSIKRKGQTPTVIMLTDGRANIARDGAQGRPKAEEDALASARAFRA
AGINSVLVDMSPRPGPQGEKIAKEMGARYLPLPYADATILSQAVLASTQAA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgcggtcgcatggtccgatgcggcgaccgcggcgcagctgttcgcggtcgat
ccggtcggcaccggcgtgctgctgcgatcccgcgcgggtccggtgcgcgaccgttggctg
gcgatgctgcgtgcggcgctgccgccgaccgacgcccataaacatctgccgctgcatatc
gccgagggccgcctgctcggcggtctcgatctgtcggcgacgctgatctccggccgcccg
gtggccgagcgcggcctgctggcggaagccgacggcggcgtcttgatgctggcgatggcg
gaacggatgccgtcctcgaccacggtgcacgtcaccgcggcgatggattcgcacgagacg
ctgatcgaacgcgacgggctgtcgctgcggatgccggcgcggttcggcgtggtggcgctg
gacgaggggctcgaggacgaagtcgccccggccgggctgtgcgatcgtctcgccttccat
ctcgagctcgatcgcttctcgttccgcgacaccgaggaattcgacatcgccgccggcgat
atcgaggtcgcgcgttctcgcttgccgtcgatccgcgcaaccgacgaacagatcgaggcg
ctggtcaacgcagcggccgcgatgggcatcgtctcgctgcgcacgccgctcttggccatc
cgcgtcgcccgcgccgccgcggcgttgagcggccataccgaaatcgatcaggaagacatt
gcgatcgccgcgcggctggtgctggcgccgcgggcgctgtacttcccgcagcccgaacag
gagccggaccaggccgagccgccgccgcccgagccgccgccggaagacaattccgaggac
aacaaggaccaggacgagcagcagatcccggacatcgaccgcgcgctcgacgagatcatc
ctcgccgcggcgaaggcggcgatcccgccggatgtgctggcgtcgctgcgtgcctcctcg
ggccgttcgcggtcgcgctcctccggcaaggccggcgagctgcagaagtcgaacaagcgc
ggccggccgaccggcacgctgcgcggcgaactgcgcgccggcgccaagctcagcgtaatc
gaaacgctgcgctcggccgcgccgtggcagccgctgcgccgtcgcgaggccgcggccgcc
ggccgcgacaccgcccagccgcagatcctgatccgcaaggacgattttcgtatcgcgcgg
ttcaagcagcgcaccgagaccaccacgatcttcgtggtcgacgcctccggctccgcggcg
ctgcatcggctcgccgaagccaagggcgcggtcgaattgctgctggccgattgctatgtc
cgccgcgaccaggtggcgatgatcgccttccgcggcgagatcgccgagatattgctgccg
ccgacgcgctccttggcgcgcgccaagcgcagcctcgcaggccttcccggcggcggcggc
acgccgctcgcggctgggctcgacgctgcgtttgcgttggcggattcgatcaagcgcaag
ggccagacgccgaccgtgatcatgctgaccgacggccgcgccaacatcgcccgcgacggc
gcccaaggccggccgaaagccgaggaagatgcgctggcttcggcgcgggcgttccgtgcc
gccggcatcaattcggtgctggtcgacatgtcgccgcggcccgggccgcagggcgagaag
atcgccaaggagatgggcgcgcgctatttgccgctgccctatgccgacgccaccatcctg
tcgcaggcggtgctagcgagcacccaggcggcctga

DBGET integrated database retrieval system