KEGG   Rhodopseudomonas palustris BisA53: RPE_1341Help
Entry
RPE_1341          CDS       T00400                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RPE_1341
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPE_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1505712..1506149)
Genome map
AA seq 145 aa AA seqDB search
MERDVVKKIVTFMALAVAGSLSSGAASAQDAANGEKVFKQCMTCHRIGPDAKNLVGPVLT
GVIGRKTGTAPGFAYSPLNKNAGEAGLVWTQDLIVQYLPDPNAFLKKFLTDKGHADQAVG
ITKMTFKLADEKQRKDVAAYIATFK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggagagagacgtggtgaagaaaatcgtgacgttcatggcgcttgccgtggccggctct
ttgtcgagcggcgcggcttcggcgcaggatgccgccaatggcgaaaaggtgttcaagcag
tgcatgacctgccaccgtatcggtcccgatgccaagaacctggtgggaccggttctgacg
ggcgtcatcggccgcaagaccggcaccgccccgggcttcgcctactcgccgctgaacaag
aatgccggtgaagccggtctggtgtggacccaggacctgatcgtgcagtatctgcccgat
ccgaacgccttcctgaagaagttcctcaccgacaagggccatgcggatcaggctgtcggc
atcaccaagatgaccttcaagctggctgatgaaaagcagcgcaaggacgtcgccgcctac
atcgcgaccttcaagtaa

DBGET integrated database retrieval system