KEGG   Rhodopseudomonas palustris BisA53: RPE_1344Help
Entry
RPE_1344          CDS       T00400                                 

Definition
heme oxygenase (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPE_1344
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.3  heme oxygenase (biliverdin-producing)
     RPE_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1510013..1510702)
Genome map
AA seq 229 aa AA seqDB search
MTAATASRPERTGIVAALYVRTRALHLEAEQSGIIADILRGEASPAGYVLLLRNLHAAYD
AMEQGLARHYQTPGLARLSAYRFDRAGAIGADLAALCGDNWRSTIPLLPAGEAYADAITR
AAEGDGSWLIAHAYTRYLGDLSGGQIVQKLLAKSMQLRPDQLSMYAFAGFPDPVVLKSEY
RHALEEAGADLIDPASVVEQGATAFTLNIALSVAVKNSVAEQARVGRTS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcaacggcaagcagacccgagcggaccggcatcgtcgcggcgctctacgtt
cgaaccagggcgctccacctcgaggccgaacaatccggaatcatcgccgatatcctgcgc
ggcgaggccagcccggctggctacgtgctgcttcttcgcaacctgcacgctgcctacgac
gcgatggagcagggtctggcacggcactatcaaacgccagggcttgctcgtctcagcgcc
tatcggttcgatcgtgccggggcgatcggcgccgatctcgccgcgctgtgcggcgacaac
tggcgcagcacaattccgctgcttccagccggcgaggcctatgccgacgcgatcacgcga
gccgcggagggcgatggcagctggctgatcgcccatgcctatacgcgctatctcggcgac
ctcagtggcggccaaatcgtgcaaaagctgttggcaaagtcgatgcagcttcgtcccgat
caattgtcgatgtacgccttcgccggcttccccgatccggtggtcttgaagagcgaatac
cgccacgccctcgaagaggccggcgctgacctaatcgatcctgcgagcgtcgtcgaacag
ggcgctaccgcgttcacgctcaacatcgcgctgtcggtcgcggtgaagaattctgtggcg
gagcaggcgcgcgtcggccgaacctcctga

DBGET integrated database retrieval system