KEGG   Rhodopseudomonas palustris BisA53: RPE_1344Help
Entry
RPE_1344          CDS       T00400                                 

Definition
heme oxygenase (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1510013..1510702)
Genome map
AA seq 229 aa AA seqDB search
MTAATASRPERTGIVAALYVRTRALHLEAEQSGIIADILRGEASPAGYVLLLRNLHAAYD
AMEQGLARHYQTPGLARLSAYRFDRAGAIGADLAALCGDNWRSTIPLLPAGEAYADAITR
AAEGDGSWLIAHAYTRYLGDLSGGQIVQKLLAKSMQLRPDQLSMYAFAGFPDPVVLKSEY
RHALEEAGADLIDPASVVEQGATAFTLNIALSVAVKNSVAEQARVGRTS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcaacggcaagcagacccgagcggaccggcatcgtcgcggcgctctacgtt
cgaaccagggcgctccacctcgaggccgaacaatccggaatcatcgccgatatcctgcgc
ggcgaggccagcccggctggctacgtgctgcttcttcgcaacctgcacgctgcctacgac
gcgatggagcagggtctggcacggcactatcaaacgccagggcttgctcgtctcagcgcc
tatcggttcgatcgtgccggggcgatcggcgccgatctcgccgcgctgtgcggcgacaac
tggcgcagcacaattccgctgcttccagccggcgaggcctatgccgacgcgatcacgcga
gccgcggagggcgatggcagctggctgatcgcccatgcctatacgcgctatctcggcgac
ctcagtggcggccaaatcgtgcaaaagctgttggcaaagtcgatgcagcttcgtcccgat
caattgtcgatgtacgccttcgccggcttccccgatccggtggtcttgaagagcgaatac
cgccacgccctcgaagaggccggcgctgacctaatcgatcctgcgagcgtcgtcgaacag
ggcgctaccgcgttcacgctcaacatcgcgctgtcggtcgcggtgaagaattctgtggcg
gagcaggcgcgcgtcggccgaacctcctga

DBGET integrated database retrieval system