KEGG   Rhodopseudomonas palustris BisA53: RPE_1344Help
Entry
RPE_1344          CDS       T00400                                 

Definition
(GenBank) Heme oxygenase (decyclizing)
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPE_1344
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     RPE_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1510013..1510702)
Genome map
AA seq 229 aa AA seqDB search
MTAATASRPERTGIVAALYVRTRALHLEAEQSGIIADILRGEASPAGYVLLLRNLHAAYD
AMEQGLARHYQTPGLARLSAYRFDRAGAIGADLAALCGDNWRSTIPLLPAGEAYADAITR
AAEGDGSWLIAHAYTRYLGDLSGGQIVQKLLAKSMQLRPDQLSMYAFAGFPDPVVLKSEY
RHALEEAGADLIDPASVVEQGATAFTLNIALSVAVKNSVAEQARVGRTS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcaacggcaagcagacccgagcggaccggcatcgtcgcggcgctctacgtt
cgaaccagggcgctccacctcgaggccgaacaatccggaatcatcgccgatatcctgcgc
ggcgaggccagcccggctggctacgtgctgcttcttcgcaacctgcacgctgcctacgac
gcgatggagcagggtctggcacggcactatcaaacgccagggcttgctcgtctcagcgcc
tatcggttcgatcgtgccggggcgatcggcgccgatctcgccgcgctgtgcggcgacaac
tggcgcagcacaattccgctgcttccagccggcgaggcctatgccgacgcgatcacgcga
gccgcggagggcgatggcagctggctgatcgcccatgcctatacgcgctatctcggcgac
ctcagtggcggccaaatcgtgcaaaagctgttggcaaagtcgatgcagcttcgtcccgat
caattgtcgatgtacgccttcgccggcttccccgatccggtggtcttgaagagcgaatac
cgccacgccctcgaagaggccggcgctgacctaatcgatcctgcgagcgtcgtcgaacag
ggcgctaccgcgttcacgctcaacatcgcgctgtcggtcgcggtgaagaattctgtggcg
gagcaggcgcgcgtcggccgaacctcctga

DBGET integrated database retrieval system