KEGG   Rhodopseudomonas palustris BisA53: RPE_1344Help
Entry
RPE_1344          CDS       T00400                                 

Definition
(GenBank) Heme oxygenase (decyclizing)
  KO
K21480  heme oxygenase (biliverdin-producing, ferredoxin) [EC:1.14.15.20]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00860  Porphyrin and chlorophyll metabolism
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPE_1344
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.20  heme oxygenase (biliverdin-producing, ferredoxin)
     RPE_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Heme_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABJ05296
JGI: RPE1344
UniProt: Q07RY8
Position
complement(1510013..1510702)
Genome map
AA seq 229 aa AA seqDB search
MTAATASRPERTGIVAALYVRTRALHLEAEQSGIIADILRGEASPAGYVLLLRNLHAAYD
AMEQGLARHYQTPGLARLSAYRFDRAGAIGADLAALCGDNWRSTIPLLPAGEAYADAITR
AAEGDGSWLIAHAYTRYLGDLSGGQIVQKLLAKSMQLRPDQLSMYAFAGFPDPVVLKSEY
RHALEEAGADLIDPASVVEQGATAFTLNIALSVAVKNSVAEQARVGRTS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcaacggcaagcagacccgagcggaccggcatcgtcgcggcgctctacgtt
cgaaccagggcgctccacctcgaggccgaacaatccggaatcatcgccgatatcctgcgc
ggcgaggccagcccggctggctacgtgctgcttcttcgcaacctgcacgctgcctacgac
gcgatggagcagggtctggcacggcactatcaaacgccagggcttgctcgtctcagcgcc
tatcggttcgatcgtgccggggcgatcggcgccgatctcgccgcgctgtgcggcgacaac
tggcgcagcacaattccgctgcttccagccggcgaggcctatgccgacgcgatcacgcga
gccgcggagggcgatggcagctggctgatcgcccatgcctatacgcgctatctcggcgac
ctcagtggcggccaaatcgtgcaaaagctgttggcaaagtcgatgcagcttcgtcccgat
caattgtcgatgtacgccttcgccggcttccccgatccggtggtcttgaagagcgaatac
cgccacgccctcgaagaggccggcgctgacctaatcgatcctgcgagcgtcgtcgaacag
ggcgctaccgcgttcacgctcaacatcgcgctgtcggtcgcggtgaagaattctgtggcg
gagcaggcgcgcgtcggccgaacctcctga

DBGET integrated database retrieval system