KEGG   Rhodopseudomonas palustris BisA53: RPE_1395Help
Entry
RPE_1395          CDS       T00400                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rpe01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rpe00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1569592..1571226
Genome map
AA seq 544 aa AA seqDB search
MNFQPRGLTDLAQKPASYQSEVEAAEALLKDKGTWNGVKAEAIARMRLQNRFKTGLDVAR
YTAALMRADMAAYDADPTKYTQSLGCWHGFIAQQKLISVKKHFGTTDRTYLYLSGWMIAA
LRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADARELNTIFRDLDAARKAGDKAKETAL
IAKIDNFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDG
KVTVPHEVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAVSHQPGDIGDQYNS
YLDCEEVDASKIGNGDVIISRGGKLLRPKRLPSNLYQFREGTGADRCVLDCITSLQNGAD
LLWIETEKPNIEQIASMVDRIREVIPNAKLAYNNSPSFNWTLNFRWQVYDTMKAAGKDVS
QYNRAELMKAEYDTTPLAIEADELIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAK
EYFGEQGMLGYVKGVQRQEIRQGIACVKHQDMAGSNIGDDHKEYFAGEAALKAGGAHNTM
NQFG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccagccacgtggcctcaccgatctggcccagaagccggcctcctatcagagc
gaagtcgaagcggccgaagctctcctcaaggacaagggcacgtggaatggcgtgaaggcc
gaagccatcgcgcgcatgcgcctgcagaaccgcttcaagaccggcctcgacgtcgcgcgc
tacaccgccgcgctgatgcgcgccgacatggcggcctatgatgccgatcccaccaagtac
actcagtcgctcggttgctggcacggcttcatcgcccagcagaagctgatctcggtcaag
aagcatttcggcaccaccgaccgcacctatctgtatctctccggctggatgatcgcggcg
ctgcgttcggaattcggaccgctgcccgaccagtcgatgcacgagaagacctcggtgccg
gcgctgatcgaagagctctacaccttcctgcgtcaggccgacgcccgtgagctcaacacg
attttccgcgacctcgacgccgcccgcaaggccggcgacaaggcgaaggaaaccgcgctg
atcgccaagatcgacaatttccagacccacgtggtgccggtgatcgccgacatcgacgcc
ggcttcggcaatgcggaagcgacctatctcttggccaagaagatgatcgaagccggcgcc
tgcgcgctgcagatcgaaaaccaggtgtccgacgaaaagcagtgcggccaccaggacggc
aaggtcacggtgccgcacgaggtcttcctggcgaagatccgcgcctgccgccacgccttc
ctcgaactcggcgtcgaagacggcatcatcgtcacccgcaccgattcgctcggcgccggc
ctgacccagcagatcgccgtcagccatcagccgggcgacatcggtgaccagtacaacagc
tacctcgattgcgaggaagtcgacgccagcaagatcggcaacggcgacgtcatcatcagc
cgcggcggtaagctgctgcgcccgaagcgcctgcccagcaatctgtaccagttccgcgaa
ggcaccggtgcggaccgctgcgtgctcgactgcatcacctcgctgcagaacggcgcggac
ctgctgtggatcgagaccgagaagccgaacatcgagcagatcgcctcgatggtcgatcgc
atccgcgaagtgatcccgaacgccaagctggcctacaacaactcgccgtcgttcaactgg
acgctcaacttccgctggcaggtgtacgacaccatgaaggctgccggtaaggacgtcagc
cagtacaaccgcgccgagctgatgaaggcggagtacgacaccacgccgctggcgatcgaa
gccgacgagctgatccggaccttccaggccgattcggccaaacgcgccggcatcttccat
catttgatcacgttgccgacctatcacacggcggcgctgtcgaccgacaatctcgccaag
gaatatttcggcgagcagggcatgctcggctacgtcaagggtgttcagcgtcaggagatc
cgtcagggcatcgcctgcgtgaagcatcaggacatggccggctccaacatcggcgacgat
cacaaggaatacttcgccggcgaggcggctttgaaggccggcggcgcgcacaacacgatg
aaccagttcggttaa

DBGET integrated database retrieval system