KEGG   Rhodopseudomonas palustris BisA53: RPE_1757Help
Entry
RPE_1757          CDS       T00400                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPE_1757
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPE_1757
   00630 Glyoxylate and dicarboxylate metabolism
    RPE_1757
Enzymes [BR:rpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPE_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1954061..1956223)
Genome map
AA seq 720 aa AA seqDB search
MKRIDAHGLQISPVLFDFIAKEAAPKTGVAPDAFWAGLAGIVQDLGPKVGALLKVRDELQ
AKIDAWHLANKGKKQDMAAYTAFLKEIGYLLPEPATMAVETANIDAEIGQLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPHDATETGKGYNKARGDKVIAKAKALLDQAAPL
ATASHTDVTSYSVIAGQLSVKLKSGNSTGLKNAAQFAGFQGDAAVPTAILLVNNGLHIEI
KIDRASVIGKDDAAGVADMILESAVSTILDMEDSVAAVDAEDKVLIYRNVLGLMDGTLSA
DFEKGGKTLTRAMNADRSYQTPDGKGLTLHGRSLLLMRNVGHHMYTDAVLDSTGAEIPEG
FLDAAVAGLLAIPDLKGTSKTRNSRTGSVYIVKPKMHGPDEVALTVDLFGRVEKVLGLPE
NTLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMK
AQPWIKAYEDWNVDIGLIDSLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPS
PTAATLHALHYHQVDVLKRQQELKTGGPRAKLDDILTIPVSQSNWAPDDVRQEIDNNCQG
ILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTQDQVMESLKR
MAVVVDKQNEGDPLYKPMAPSFDGVAFKAASDLIFKGRAQPNGYTEFILTARRREAKAAG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatcgacgcccacggcctgcagatttcacccgttttgttcgacttcatcgcc
aaggaggccgcgcccaagaccggggtcgcgccggacgccttctgggccgggctcgcgggc
atcgtacaggatctgggaccgaaggtcggcgcgctgctgaaagttcgcgacgagttgcag
gccaagatcgacgcctggcacctcgccaacaagggcaagaagcaggacatggcggcctat
accgccttcctgaaggaaatcggctatctgctgccggagcccgcgacgatggcggtcgag
accgccaatatcgacgcggaaatcggtcagttgtgcggcccgcagctggtggtgccgctg
tcgaacgcgcgctacgcgctgaacgcggcgaatgcgcgctggggctcgctgtacgacgcg
ttctacggcaccgacgcgatcccgcacgatgccaccgagaccggcaagggctacaacaag
gcgcgcggcgacaaggtgatcgccaaggccaaggcgctgctcgaccaggccgccccgctc
gccaccgcgagccacaccgacgtcacctcctatagcgtgatcgccgggcaattgtcggtg
aagctgaagagcggcaattccaccggactgaaaaatgccgcgcaattcgccggcttccag
ggcgatgcggcggtgccgaccgcgatcctgctggtcaacaacggtctgcatatcgagatc
aagatcgaccgtgccagcgtcatcggcaaggacgacgccgcgggcgtcgccgatatgatc
ctggaatccgcggtctccaccattctggacatggaagactcggtcgccgcggtcgacgcc
gaggacaaggtgctgatctatcgcaacgtgctcggcctgatggacggcacgctgtcggcg
gatttcgagaagggcggcaagacgctgacccgggcgatgaacgccgaccgcagctaccag
accccggacggcaagggcctcacgctgcacgggcgcagcctgctgctgatgcgcaatgtc
ggccatcatatgtacaccgacgcggtgctggattcgaccggcgccgaaatcccggaaggc
tttctcgacgccgcggtcgcgggcctgttggcgattcccgacctcaagggcaccagcaag
acccgcaacagccgcaccggctcggtctatatcgtcaagccgaagatgcacggccccgac
gaagtggcgctgaccgtcgatctgttcggccgtgtcgaaaaggttctcggcctgccggag
aacacgctgaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctcaaggcc
tgcattcagaatgccagcaagcgcatcgtcttcatcaacaccggcttcctggaccgcacc
ggtgacgagattcacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaag
gcgcagccctggatcaaggcctatgaagactggaacgtcgacatcggcctgatcgactcg
ctccccggccacgcccagatcggcaaggggatgtgggcggcgcccgacaagatggcggat
atgctggcgcagaagatcggccatccgcaggccggcgccaccaccgcctgggtgccttcg
cccaccgcggcgacgctgcacgcgctgcactatcaccaggtcgacgtgctgaagcgccag
caggagctgaagaccggcggcccgcgcgcaaaactcgacgacatcctcaccattccggtg
tcgcaatccaactgggcgccggacgacgtccgccaggagatcgacaacaactgccagggc
attttgggctatgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggac
atccacgatgtcgggctgatggaagaccgcgccacgctgcgcatctccagccagcacctc
gccaattggctgcatcacggcgtggtcacgcaagatcaggtgatggagtcgctgaagcgg
atggcggtggtggtcgacaagcagaacgaaggcgatccgctctacaagccgatggcgcct
tccttcgacggcgtcgccttcaaggcggcgagcgacctgatcttcaagggccgcgcgcag
ccgaacggctacaccgagttcatcctcaccgcgcgtcgccgcgaggccaaggcggccggc
taa

DBGET integrated database retrieval system