KEGG   Rhodopseudomonas palustris BisA53: RPE_1773Help
Entry
RPE_1773          CDS       T00400                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPE_1773
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPE_1773
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPE_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1971930..1972718
Genome map
AA seq 262 aa AA seqDB search
MENLTGKTAVVTGSTSGIGLAYARAFAGAGANVVINGMGEAADIERERAKIESDFGVKAV
YSPADMLKPAEIAEMVALGETTFGAVDILVNNAGIQFVSPIEDFPIEKWDAIIAINLSSA
FHGIRAVVPGMKKRGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTAALELATHKI
TVNCISPGYVWTPLVEKQIPDTMKARNLTKEQVINDVLLLAQPTKQFVTSEQVAALALYL
CGDDASQITGANLSMDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggagaatttgacaggcaagaccgccgtggtgaccggctcgaccagcggcatcggcttg
gcctatgcgcgcgccttcgccggcgccggcgccaatgtcgtgatcaacggcatgggcgag
gccgccgacatcgagcgcgagcgcgccaagatcgagagcgatttcggcgtcaaggcggtg
tattcgccggccgacatgctgaagccggccgagatcgccgagatggtcgcgctcggcgag
acgacgttcggcgcggtcgacatcctggtcaacaatgccggcatccagttcgtctcgccg
atcgaggattttccgatcgagaaatgggacgccatcatcgccatcaacctgtcgtcggcg
ttccacggcatccgcgccgtggtgccgggcatgaagaagcgcggctggggccgcatcatc
aacaccgcctcggcgcattcgctggtggcctcgccgttcaaatcggcctatgtcgccgcc
aagcacggcatcgccggcctcaccaagaccgctgcgctggagctcgccacccacaagatc
accgtgaactgcatctcgccgggctatgtctggacgcccttggttgaaaagcagatcccc
gacaccatgaaggcgcgcaatctcaccaaggagcaggtgatcaacgacgtgctcttgcta
gcgcagccgaccaagcagttcgtcacctccgaacaggtcgcggccttggcgctctatctg
tgcggcgacgacgccagccagatcaccggcgccaatttgtcgatggacggcggctggacc
gcggcttga

DBGET integrated database retrieval system