KEGG   Rhodopseudomonas palustris BisA53: RPE_1836Help
Entry
RPE_1836          CDS       T00400                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RPE_1836
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPE_1836
   00650 Butanoate metabolism
    RPE_1836
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_1836
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPE_1836
   00310 Lysine degradation
    RPE_1836
   00360 Phenylalanine metabolism
    RPE_1836
   00380 Tryptophan metabolism
    RPE_1836
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPE_1836
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPE_1836
   00281 Geraniol degradation
    RPE_1836
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPE_1836
   00627 Aminobenzoate degradation
    RPE_1836
   00930 Caprolactam degradation
    RPE_1836
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPE_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2050524..2051303)
Genome map
AA seq 259 aa AA seqDB search
MNSYDHIIVERQAAVGVIRINRPKMLNALSFGVFGEIAKAIDELEADAAIGCIVLTGSEK
AFAAGADIKEMQPKGFIDMFNADFHSIGGDRVATCRKPTIAAVSGYALGGGCELAMMCDF
IIAADTAKFGQPEITLGTIPGIGGTQRLTRAIGKSKAMDLCLTGRMMDAAEAERAGLVSR
IVPADRLMEEAMAAAEKIASMSQPAAAMAKNAVNRAFETTLAEGMSVERDLFHATFALED
RAEGMAAFIEKRPPQIRNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctacgaccacatcatcgtcgaacgccaggccgcggtcggcgttatccgtatc
aaccgtcccaaaatgctgaacgcgctgtcgttcggcgtgttcggcgagatcgccaaggcg
atcgacgaattggaggccgacgccgccatcggctgcatcgtgctgaccggcagcgaaaag
gcgttcgccgccggcgccgatatcaaggagatgcagccgaaaggcttcatcgacatgttc
aacgccgatttccactcgatcggcggcgaccgcgtcgccacctgccgcaagccgaccatc
gccgccgtgtccggctatgcgttgggcggcggctgcgaactggcgatgatgtgcgacttc
atcatcgccgccgacaccgccaaattcggccagccggagatcacgctcggcaccattccg
ggcatcggcggcacccagcggctgacccgcgcgatcggcaaatcgaaggcgatggacctc
tgcctcaccggccggatgatggacgccgccgaggccgaacgcgccgggctggtcagccgc
atcgtgccggccgacagactgatggaagaagccatggccgccgccgagaagatcgcctcg
atgtcgcagcccgccgcggcgatggcgaagaacgcggtcaaccgcgcgttcgagaccacg
ctggcggaaggcatgagcgtcgagcgcgacctgtttcacgccaccttcgcgctggaggat
cgcgccgaaggcatggcggcgttcatcgagaaacggccgccacaaatccgcaatcgctga

DBGET integrated database retrieval system