KEGG   Rhodopseudomonas palustris BisA53: RPE_1836Help
Entry
RPE_1836          CDS       T00400                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00071  Fatty acid degradation
rpe00280  Valine, leucine and isoleucine degradation
rpe00281  Geraniol degradation
rpe00310  Lysine degradation
rpe00360  Phenylalanine metabolism
rpe00362  Benzoate degradation
rpe00380  Tryptophan metabolism
rpe00410  beta-Alanine metabolism
rpe00627  Aminobenzoate degradation
rpe00640  Propanoate metabolism
rpe00650  Butanoate metabolism
rpe00903  Limonene and pinene degradation
rpe00930  Caprolactam degradation
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
rpe01130  Biosynthesis of antibiotics
rpe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPE_1836
   00650 Butanoate metabolism
    RPE_1836
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_1836
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPE_1836
   00310 Lysine degradation
    RPE_1836
   00360 Phenylalanine metabolism
    RPE_1836
   00380 Tryptophan metabolism
    RPE_1836
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPE_1836
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPE_1836
   00281 Geraniol degradation
    RPE_1836
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPE_1836
   00627 Aminobenzoate degradation
    RPE_1836
   00930 Caprolactam degradation
    RPE_1836
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPE_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABJ05784
JGI: RPE1836
UniProt: Q07QK0
Position
complement(2050524..2051303)
Genome map
AA seq 259 aa AA seqDB search
MNSYDHIIVERQAAVGVIRINRPKMLNALSFGVFGEIAKAIDELEADAAIGCIVLTGSEK
AFAAGADIKEMQPKGFIDMFNADFHSIGGDRVATCRKPTIAAVSGYALGGGCELAMMCDF
IIAADTAKFGQPEITLGTIPGIGGTQRLTRAIGKSKAMDLCLTGRMMDAAEAERAGLVSR
IVPADRLMEEAMAAAEKIASMSQPAAAMAKNAVNRAFETTLAEGMSVERDLFHATFALED
RAEGMAAFIEKRPPQIRNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctacgaccacatcatcgtcgaacgccaggccgcggtcggcgttatccgtatc
aaccgtcccaaaatgctgaacgcgctgtcgttcggcgtgttcggcgagatcgccaaggcg
atcgacgaattggaggccgacgccgccatcggctgcatcgtgctgaccggcagcgaaaag
gcgttcgccgccggcgccgatatcaaggagatgcagccgaaaggcttcatcgacatgttc
aacgccgatttccactcgatcggcggcgaccgcgtcgccacctgccgcaagccgaccatc
gccgccgtgtccggctatgcgttgggcggcggctgcgaactggcgatgatgtgcgacttc
atcatcgccgccgacaccgccaaattcggccagccggagatcacgctcggcaccattccg
ggcatcggcggcacccagcggctgacccgcgcgatcggcaaatcgaaggcgatggacctc
tgcctcaccggccggatgatggacgccgccgaggccgaacgcgccgggctggtcagccgc
atcgtgccggccgacagactgatggaagaagccatggccgccgccgagaagatcgcctcg
atgtcgcagcccgccgcggcgatggcgaagaacgcggtcaaccgcgcgttcgagaccacg
ctggcggaaggcatgagcgtcgagcgcgacctgtttcacgccaccttcgcgctggaggat
cgcgccgaaggcatggcggcgttcatcgagaaacggccgccacaaatccgcaatcgctga

DBGET integrated database retrieval system