KEGG   Rhodopseudomonas palustris BisA53: RPE_1855Help
Entry
RPE_1855          CDS       T00400                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2068212..2068703)
Genome map
AA seq 163 aa AA seqDB search
MASVLIALGGNVGDVRDAFARAIPMICGMAQASLEARSSDYATPPWGEESQARFVNACIE
IDSDLDPYALLFSLHKIEKRFGRDRDHETRWGPRTLDLDLLAYDDVTLDRAWMHLPHPRL
FERAFVLVPLCDIAPDRPIGGRTPREALATLSTAGIERLPDLS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgtcctgatcgcgctcggcggcaatgtcggcgatgtccgcgacgcttttgcg
cgcgccattccgatgatctgcggcatggcgcaggcctcgctcgaagcgcgctcctcggac
tatgcgaccccgccctggggcgaggagagccaggcgcgcttcgtcaacgcctgcatcgaa
atcgactccgacctcgacccctatgcgctgctgttcagcctgcacaagatcgaaaagcgg
tttggccgcgaccgcgaccacgaaacccgctggggcccgcgcacgctcgatctcgacctg
ttggcctatgacgacgtcacgctcgaccgcgcctggatgcacctgccgcatccgcggctg
ttcgagcgcgccttcgtgctggtgccgctgtgcgacatcgccccggaccggccgatcggc
ggccgcaccccgcgcgaagcgctggcgacgctctccaccgcgggcatcgagcggctgccc
gacctgtcctga

DBGET integrated database retrieval system