KEGG   Rhodopseudomonas palustris BisA53: RPE_1857Help
Entry
RPE_1857          CDS       T00400                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPE_1857
Enzymes [BR:rpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RPE_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2069073..2069930)
Genome map
AA seq 285 aa AA seqDB search
MTAPPSTPAAAAAPPDHPLLRTLLARRVPVVMGVLNITPDSFSDGGQFLAPDRARAQAAK
LIADGADIIDIGAESTRPYGAEPISAAEELARLRPVLADMVALGTPVSIDSMKAEVVAYA
LDAGAAIANDVWGLQRDPAMADVIASRGAPVIMMHNRDAADPAIDIIADLTAFFDRSLAI
AAKAGIPRAHIVLDPGIGFGKTPEQSMTALARLDALQRFALPILVGASRKRFISTVSPSE
PQQRLGGSIAAHLLAAQHGARIIRAHDVAETVQALRVACAIEDSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgccgtccacacccgccgcggcggccgcgccgccggatcatccgctgctg
cggacattgctcgcgcggcgcgtgccggtcgtgatgggcgtgctcaacatcacccccgat
tcgttttccgacggcggacagtttttggcgccggaccgcgcccgcgcccaggccgcaaag
ctgatcgccgacggcgccgacatcatcgacatcggcgcggaatccacccggccctatggc
gccgagccgatttccgcggccgaagaattggccaggctgcgcccggtgctcgccgacatg
gtagcgctcggcaccccggtctcgatcgacagcatgaaggccgaggtggtggcctacgcc
ctcgacgccggcgctgcgatcgccaacgacgtctggggattgcagcgcgatccggcgatg
gccgacgtgatcgcctcgcgcggcgcaccggtgatcatgatgcacaaccgcgacgccgcc
gatcctgccatcgacatcatcgccgacctcaccgctttcttcgaccgctcgctggcgatc
gccgccaaggctggtattccccgcgcgcatatcgtgctcgatcccggcatcggttttggc
aagacgcccgagcagagcatgacggcgctagcccggctcgacgcgttgcaacgatttgct
ctgccgatcctggtcggcgcctcgcgcaagcgtttcatcagcacggtatcgccgtcggag
ccgcaacagcggctcggcggttcgatcgccgcgcatcttttggccgcacagcacggagcg
cgaatcatccgcgcccatgacgtcgcggaaacggtgcaggcgctacgcgttgcctgcgcc
atcgaggacagccgatga

DBGET integrated database retrieval system