KEGG   Rhodopseudomonas palustris BisA53: RPE_2019Help
Entry
RPE_2019          CDS       T00400                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPE_2019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_2019
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_2019
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPE_2019
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPE_2019
   00626 Naphthalene degradation
    RPE_2019
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPE_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2233229..2234251)
Genome map
AA seq 340 aa AA seqDB search
MRALTLVADRQLVAADLPAPPAPGPGEVQIRVGAVALNHIDVWGFRGMAFVKRKLPIVVG
AEAAGTIAAVGDGVTRFKVGQKVAMYGAQTCGHCKPCLEGRDNFCENVGGLIGFHVDGFA
RELLNMPERLVIPVPDNVSVRDAACAPIAFSTVQHMLFDNAKLQPGETVLVHAGGSGIGT
VAIMMAKAIGCTVITTVGDDSKIEGVKKLGADHVINYRTDRFEHETRKITKKKGVDVVFE
HVGADTFNGSLLVMKRGGRLVTCGSTSGPTATINLMQLFQQQYRIFGSFGASIRNIAESL
DKMAAGMLPVIDTEVTIEDVEVALKRMESRQVFGKIIVRL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcaccctcgtcgccgaccgccaattggtggcagccgatctccccgccccg
cccgcaccgggcccgggagaggtgcagatccgcgtcggcgcggtggcgctcaaccacatc
gacgtctggggctttcgcggcatggctttcgtcaagcgcaagctgccgatcgtggtcggc
gcggaagccgccggcacaatcgcggcggtgggcgacggcgtcacgcgtttcaaggtcggc
cagaaggtcgcgatgtatggcgcgcagacctgcggccactgcaagccatgtctagagggc
cgcgacaatttctgcgagaacgtcggcggcctgatcggcttccatgtcgacggttttgcc
cgcgaactgttgaacatgccggagcggctggtgatcccggtgcccgacaatgtcagcgtc
cgcgacgccgcctgcgcgccgattgccttttccaccgtgcagcacatgctgttcgacaac
gccaagctgcagcccggcgaaactgtgctggtgcatgctggcggctccggcatcggcacg
gtcgcgatcatgatggcgaaggcgatcggctgcaccgtgatcaccacggtcggcgacgac
agcaagatcgagggcgtgaagaagctcggcgccgatcacgtcatcaactaccgcaccgat
cgcttcgagcacgaaacgcggaagatcaccaagaagaagggcgtcgacgtcgtgttcgaa
cacgtcggcgccgacaccttcaacggctcgctgttggtgatgaaacgtggcggccgcctg
gtgacctgcggctcgacctcaggaccgaccgccaccatcaatctgatgcagctgttccag
cagcagtaccgcatcttcggctcgttcggcgcctcgatccgcaacatcgccgagagcctc
gacaagatggcggccggcatgctcccggtgatcgacaccgaagtcaccatcgaggatgtt
gaagtcgcactgaagcgcatggaaagccgacaggtgttcggcaagatcatcgtcaggctc
tga

DBGET integrated database retrieval system