KEGG   Rhodopseudomonas palustris BisA53: RPE_2177Help
Entry
RPE_2177          CDS       T00400                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPE_2177
   00670 One carbon pool by folate
    RPE_2177
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RPE_2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2414634..2415149
Genome map
AA seq 171 aa AA seqDB search
MIDTILIVAVADNGVIGHRGAMPWRLKSDLQRFKALTLGKPVVMGRKTFASIGRPLPGRT
NIVVSRDDSLKLPGAIVTTSFAEARRIAQGDALRRFATEIAVIGGAEIYQQFLGEADRIE
LTEVHACPEGDTVFAPLDAAQWQETARIRHAAAEGDSADFSYVTYRRRTPR
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacaccatcctcatcgtcgccgtcgccgacaacggcgtgatcgggcatcgcggc
gcgatgccgtggcggctgaaatccgatctgcagcgcttcaaggcgctgacgctcggcaag
ccggtggtgatggggcgcaagaccttcgcctcgatcggccggccgctgccggggcggacc
aacatcgtggtgagccgcgacgattcgctgaagctgccgggggcgatcgtgaccacgtcg
ttcgccgaggcgcggcggatcgcccagggcgatgcactgcggcgttttgccaccgagatc
gcggtgatcggcggtgcggagatctaccagcagtttctcggcgaggccgaccgtatcgaa
ctgaccgaggtgcatgcgtgccccgagggcgataccgtttttgcgccgctggatgctgcg
caatggcaggaaaccgcgcgaatccgtcacgccgccgccgagggcgacagcgcggatttt
tcctatgtgacctatcgccgccgaacgccgcgttaa

DBGET integrated database retrieval system