KEGG   Rhodopseudomonas palustris BisA53: RPE_2196Help
Entry
RPE_2196          CDS       T00400                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpe  Rhodopseudomonas palustris BisA53
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2432315..2433157
Genome map
AA seq 280 aa AA seqDB search
MMTNDRLQKIRTLYAELIAGHHDARLREAFAAVPREPFAGPGPWLMKGQGEKYIQTPDDD
PALLYQDVRLALDAARNINIGMPSAHAMWLDAIRLDPGQQVLQVGTGSGYYTAILAHLVG
PRGRVFAYEIDQDFAARARANLSDLPQVEVRATSGIADDLPKVDAIYVCAGITQPSRAWI
DALRPGGRLLFPLQPPLGLGGMLLIECPLHDTAWPARFVSRAAFVGCVGQQDAAAGARLA
AAFAGRWDQVRSFRIDDAPDDSCWYAGDGWWLSTTAVDVG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaacgatcgattgcagaaaatccggacgctttacgccgagctgatcgccggc
catcacgacgcgcggctgcgcgaggcgttcgccgccgtgccgcgcgagccgttcgccggg
ccgggcccctggctgatgaaagggcagggcgagaagtatatccaaaccccggatgacgat
ccggcgttgctgtatcaggacgtgcggctggcgttggatgccgcgcgcaatatcaacatc
ggcatgccgagcgcgcatgcgatgtggctcgacgcgatccggctcgatccgggccaacag
gtgctgcaggtcggcactggctccggctactacaccgcgatcctggcgcatctggtcggg
ccgcgcggtcgcgtctttgcctacgagatcgatcaagattttgccgcgcgcgcccgcgca
aacctcagtgacctgccgcaggtcgaggtgagggcgacaagcggcatcgccgacgatctg
ccgaaggtcgatgcgatctacgtctgcgccggcatcacccagccgagccgggcctggatc
gacgcgctcaggcccggcgggcggctgttatttccgctgcagccgccgcttggcctcgga
ggcatgctgctgatcgagtgtccgctgcacgacaccgcgtggccggcaaggttcgtctcg
cgcgccgccttcgtcggctgcgtcggtcaacaggacgccgcagccggagcgcggctggcc
gcggcgttcgcgggccgatgggatcaggtgcgttcgttccggatcgacgacgctcccgac
gatagctgctggtatgccggcgacggctggtggctatcgaccacggcggtcgatgtggga
tag

DBGET integrated database retrieval system