KEGG   Rhodopseudomonas palustris BisA53: RPE_2397Help
Entry
RPE_2397          CDS       T00400                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RPE_2397
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RPE_2397
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RPE_2397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2641549..2642124)
Genome map
AA seq 191 aa AA seqDB search
MIDRRNFVAATLGAIASPAAIGLALAQPAASQMTAYGFSFPALSGDAIRLADFAGRPILV
VNTASQCGYTPQYAGLQALWAEFKDRGLMIIAVPSNDFGGQEPGGVSEITETAQHQYGVG
FPIAAKSVVKGPAAHPFYKWAAAARPNDTPRWNFHKYLVGRDGYLADSFATTIEPTDTRI
KTALARQLSSA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgcagaaatttcgtcgcggcgacgctgggtgccatcgcttccccggcggcg
atcggattggccttggcacagccggcggcgagccagatgaccgcatacggcttctcattt
cccgcgctttccggcgacgcgatccgcttggccgattttgccggccggccgatcctggtg
gtgaacaccgcctcgcaatgcggctataccccgcaatatgccgggctgcaggcgctgtgg
gccgagttcaaggatcgcggcctgatgatcatagccgtgccgtcgaatgatttcggcggc
caggagcccggcggcgtcagcgaaatcaccgagaccgcgcagcatcaatacggcgtcggt
tttccaattgcggcgaagtccgtggtgaaaggccccgcggcgcatccgttctacaaatgg
gcggccgcggcgcggccgaacgataccccgcgctggaatttccacaaatatctggtcggc
cgcgacggctatctcgccgacagtttcgcgaccaccatcgagccgaccgataccaggatc
aagaccgcgctggcgcgtcagctgtcgtccgcatga

DBGET integrated database retrieval system