KEGG   Rhodopseudomonas palustris BisA53: RPE_2475Help
Entry
RPE_2475          CDS       T00400                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2722151..2724310)
Genome map
AA seq 719 aa AA seqDB search
MIVVVERILSRRTFGTIFAGRDAQGALVRVKLNNGSAIGIPDVGETWSIDGSIEQSPWGP
QIKGIRAVRTLPSGRLMVEYLSASVAGIGPTRAGRLWAHFGEQLPEALDLGDVDAIAIVM
DPDRPALAPRLAAVLVSEWKRIAGEGRLIEWLAAAGIYDIRLAKRLFVLLGDQAPAKLGA
NPWCLVPFLPWRRVDRLALKLSIEAGHLSPERLERRFMGAADSVIKDVIAVGATAVSAPD
FRAMLARKLKLDALDLDHAIELALGRRAVVADADGTLRAPGCAMMEEAVSRRLKEMLRLA
PASFASATILEGLSDEQASAVRKILATGFACIRGRAGVGKTHVTKAICDVWDAAGGNLIL
AAVAGKAALRLSHATGRLARTLHRTIGELDERARILQEMDDSPGSDRRSRLESRLRELVV
ANERTLAIVDEASMLDLANLYKLLDRLPAGAKMVLIGDECQLPPVSFGLTFHRLARDASV
TATLSRIHRQAKQSEIPKVASAIRRRETPELATYDGEHQGVFLVHAQLREAIAENVTKVF
GQLSRQTDTMIVTPVNETVVGVAGLNRRLHDAYVERTSLQELRGPLGDLFSAGEPVVHRR
NDYHRGLWNGSTGTVFRIDRDRRSLTAIFDDREHVFASDDLVDISLGYALTCHRSQGSEA
TNVIVALPPSRLLDPSWLYTALTRAKTLAVIVGQHETIENALRRPYADESRLVGLRWPN
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtggtcgaacgcattcttagccgtcggacctttggcacgatcttcgccggc
cgcgatgcgcaaggcgcgctcgtccgcgtgaaattgaacaatggctcggccatcggaatt
ccagacgtcggcgaaacctggtccatcgacggctctattgaacagtccccttggggtccg
cagataaaaggcatccgggccgtacggaccttgccgagcggccgtctgatggttgagtac
ctctcggcatccgtcgcgggcatcggcccgacgcgcgcgggccgcctatgggcgcatttc
ggcgagcaactgcccgaagcgctagacttgggcgacgtcgatgccattgccatcgtcatg
gatcccgaccgcccagctctggcccctcgccttgccgccgtgctcgtgtccgagtggaag
aggatcgccggcgaaggccgtttgatcgagtggctagctgcggctgggatctacgacatc
aggctggcgaagcgcctctttgtcctcttgggcgaccaggcaccggcgaagctcggggca
aacccgtggtgccttgtaccatttcttccatggcgccgcgtcgaccggcttgccctcaag
ctttcgatagaggccggccatctgtctcccgaacgtctcgaacgccgcttcatgggggct
gcggattccgtcattaaagatgtgattgccgtaggcgccactgcggtctctgcgccggac
ttccgtgcgatgctcgccaggaagctcaaactcgacgcccttgatttagaccacgccatc
gaactcgctcttggtcgacgcgccgtagtagccgatgccgatggtaccctccgtgcacct
ggctgcgcgatgatggaagaggcggtctcgcgccgcttgaaggaaatgctgcgcctcgcg
ccggcttcgttcgcttctgcaacgatcctggaagggctctccgacgagcaggcctcggcc
gtcaggaagatccttgcgaccggttttgcgtgtatccgcggccgcgcgggggtaggtaag
actcacgtgaccaaggcgatctgtgacgtctgggatgcggctggcggcaatctcattctc
gctgccgtggccggaaaggctgcactgcggctttcccacgcgacgggtcgactagcgcgg
accctccatcgcacgatcggcgagctcgacgagcgagcccggattctgcaagagatggac
gactcgccggggtccgatagacgatcgaggctagaatcacgtctgcgcgagcttgtcgta
gccaacgagcggactcttgcgatcgtcgacgaggcgtcgatgcttgatttggcgaacctt
tacaaactgctggatcgcctgcccgccggcgcaaaaatggttttgatcggggacgagtgc
cagctgcctcccgtctctttcgggttgacattccatcgcctggcgcgcgatgcgtccgtc
acggcgacactctcgaggatacatcgccaggcaaaacagtccgagattccaaaggtggcc
agcgcgatccgccgccgggagacgcccgagctcgcaacttacgatggcgaacatcagggc
gtctttctagttcacgcgcaattacgcgaagcaatagccgaaaacgtcacgaaggtgttc
ggccagctgtctcggcagactgacaccatgatcgttacgcccgtcaacgaaaccgttgtc
ggcgtggcaggtctcaaccggagacttcacgacgcttacgtcgagcgcactagccttcag
gagcttcggggcccgctcggtgatctcttctctgcgggtgagccggtcgtccaccgccgt
aacgactatcaccgaggcctctggaacggctcgacgggcacggtgttcaggatcgaccgg
gaccgtcgcagcctgaccgccatcttcgacgatcgagagcatgtcttcgcctccgacgac
ctcgtcgacatttcgctgggctacgccctaacctgccatcgcagccaaggcagcgaggcc
actaacgtgatcgtagctttgccaccatcccgacttttggatccttcctggctatatacg
gcgctcacacgcgcgaagacgcttgccgtcatcgtggggcagcatgaaaccatcgagaat
gcactgcgacgtccctacgccgatgaaagtcgtctcgtcggtctaagatggcccaactag

DBGET integrated database retrieval system