KEGG   Rhodopseudomonas palustris BisA53: RPE_2590Help
Entry
RPE_2590          CDS       T00400                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01130  Biosynthesis of antibiotics
rpe01230  Biosynthesis of amino acids
Module
rpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPE_2590
Enzymes [BR:rpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RPE_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABJ06528
JGI: RPE2590
UniProt: Q07NF6
Position
complement(2860358..2861179)
Genome map
AA seq 273 aa AA seqDB search
MSDILTRIEAYKREEIAAAKRARPIAELEVAAKTASPPRGFVAAIRRKLAEGDYALIAEI
KKASPSKGLIRVDFDPPALAQAYQAGGAACLSVLTDTPSFQGHLDFMVAAREAVALPVLR
KDFVYDTYQVVEARAHGADCILIIMAALDDATAKDIEDAAIDLGMDVLIEIHNHDELERA
LKLRSPMIGVNNRNLRTFDVTLATSEALAPLIPSERLMVGESGIFAPADLARLERVGIAT
FLVGESLMRQSDVTAATRALLARDAALRPTGTV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatattctcaccaggatcgaggcctataagcgcgaggagatcgcggccgccaag
cgcgcccgcccgatcgccgagctcgaggtcgcggccaaaaccgcctcgccgccgcgcggc
ttcgtcgccgcgatccgccgcaagctggcggaaggcgactacgcgctgatcgccgagatc
aagaaggcctcgccgtcaaaggggctgatccgggtcgatttcgatccgccggcgcttgcg
caagcctatcaggccggcggcgcggcctgcctgtcggtgttgaccgatacgccgtcgttc
cagggccatctcgacttcatggtcgcggcgcgcgaagcggtggcgctgccggtgctgcgc
aaggattttgtctacgacacctatcaggtggtggaggcgcgcgcgcacggcgccgactgc
atcctgatcatcatggcggcgctcgacgacgccaccgcgaaagacatcgaggacgccgcg
atcgatctcggcatggacgtgctgatcgaaatccacaatcacgacgaattggaacgcgcg
ctgaaactgcggtcgccgatgatcggcgtcaacaaccgtaacctgcgcactttcgacgtc
acgctcgcgaccagcgaggcgttggcgccgttgattccgagcgaacgcctgatggtcggc
gagagcggcatcttcgcccccgccgatctggcgcggctcgagcgcgtcggcatcgccacc
ttcctggtcggcgaaagcctgatgcgccagtccgacgtcaccgcagcgacccgcgcgctg
ctggctcgcgacgccgcgctacgcccgaccggaaccgtctga

DBGET integrated database retrieval system