KEGG   Rhodopseudomonas palustris BisA53: RPE_2593Help
Entry
RPE_2593          CDS       T00400                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00010  Glycolysis / Gluconeogenesis
rpe00051  Fructose and mannose metabolism
rpe00562  Inositol phosphate metabolism
rpe00710  Carbon fixation in photosynthetic organisms
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
rpe01130  Biosynthesis of antibiotics
rpe01200  Carbon metabolism
rpe01230  Biosynthesis of amino acids
Module
rpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rpe_M00002  Glycolysis, core module involving three-carbon compounds
rpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_2593
   00051 Fructose and mannose metabolism
    RPE_2593
   00562 Inositol phosphate metabolism
    RPE_2593
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPE_2593
Enzymes [BR:rpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RPE_2593
Exosome [BR:rpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RPE_2593
  Exosomal proteins of bladder cancer cells
   RPE_2593
  Exosomal proteins of melanoma cells
   RPE_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABJ06531
JGI: RPE2593
UniProt: Q07NF3
Position
2864436..2865197
Genome map
AA seq 253 aa AA seqDB search
MPAAIRALIAGNWKMNGLKAQLAEFEAMLAGAPALADKADLLVCPPATLLHAFGQKLGNG
ARSFAVGAQDCHANVSGAHTGDLSAEMLVDAGASAIIVGHSERRADHGETDSVVRAKAEA
AWRAGAVAIVCVGETQAERDAGQTLDVVGRQLAGSLPDGATAENTVVAYEPVWAIGTGLT
PTANDVEQVHKFIRDCLTKRFGGEGAAVRILYGGSVKPSNAKELMAVPEVNGALVGGASL
KAADFLAIAAGCP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccgccattcgtgcgctgatcgccggaaactggaagatgaacgggctgaaagcc
cagctcgccgagttcgaggcgatgctggccggcgccccggcgctggccgacaaggcggac
ctgctggtctgcccgcccgctacgctgctgcatgcgttcgggcagaagctcggcaacggc
gcgcgcagcttcgcggtcggcgcgcaggactgccacgccaacgtctcaggcgcgcacacc
ggcgacctttccgccgagatgctggtcgatgccggcgccagcgccatcatcgtaggccat
tccgagcgccgcgccgaccatggcgagaccgattccgtggtgcgggccaaggccgaggcc
gcctggcgcgccggggcggttgcgatcgtctgcgttggcgaaacccaagccgagcgcgac
gcgggccagacgctggatgtggtcggccgccagctcgccggttcgctgccggatggggct
accgcggaaaataccgtcgttgcctacgagccggtctgggcgatcggcaccggcctgacc
ccgaccgcaaacgatgtcgagcaagttcataagtttatccgggattgcttgactaaaagg
tttggcggcgagggggctgcggtgcggattctctacggcggttcggtcaaaccctcgaac
gccaaggaactgatggcggtgcccgaggtgaacggcgcgctggtcggtggcgccagcctg
aaggcggccgacttccttgccatcgccgccggctgcccctag

DBGET integrated database retrieval system