KEGG   Rhodopseudomonas palustris BisA53: RPE_2593Help
Entry
RPE_2593          CDS       T00400                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPE_2593
   01230 Biosynthesis of amino acids
    RPE_2593
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_2593
   00051 Fructose and mannose metabolism
    RPE_2593
   00562 Inositol phosphate metabolism
    RPE_2593
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPE_2593
Enzymes [BR:rpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RPE_2593
Exosome [BR:rpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RPE_2593
  Exosomal proteins of bladder cancer cells
   RPE_2593
  Exosomal proteins of melanoma cells
   RPE_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2864436..2865197
Genome map
AA seq 253 aa AA seqDB search
MPAAIRALIAGNWKMNGLKAQLAEFEAMLAGAPALADKADLLVCPPATLLHAFGQKLGNG
ARSFAVGAQDCHANVSGAHTGDLSAEMLVDAGASAIIVGHSERRADHGETDSVVRAKAEA
AWRAGAVAIVCVGETQAERDAGQTLDVVGRQLAGSLPDGATAENTVVAYEPVWAIGTGLT
PTANDVEQVHKFIRDCLTKRFGGEGAAVRILYGGSVKPSNAKELMAVPEVNGALVGGASL
KAADFLAIAAGCP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccgccattcgtgcgctgatcgccggaaactggaagatgaacgggctgaaagcc
cagctcgccgagttcgaggcgatgctggccggcgccccggcgctggccgacaaggcggac
ctgctggtctgcccgcccgctacgctgctgcatgcgttcgggcagaagctcggcaacggc
gcgcgcagcttcgcggtcggcgcgcaggactgccacgccaacgtctcaggcgcgcacacc
ggcgacctttccgccgagatgctggtcgatgccggcgccagcgccatcatcgtaggccat
tccgagcgccgcgccgaccatggcgagaccgattccgtggtgcgggccaaggccgaggcc
gcctggcgcgccggggcggttgcgatcgtctgcgttggcgaaacccaagccgagcgcgac
gcgggccagacgctggatgtggtcggccgccagctcgccggttcgctgccggatggggct
accgcggaaaataccgtcgttgcctacgagccggtctgggcgatcggcaccggcctgacc
ccgaccgcaaacgatgtcgagcaagttcataagtttatccgggattgcttgactaaaagg
tttggcggcgagggggctgcggtgcggattctctacggcggttcggtcaaaccctcgaac
gccaaggaactgatggcggtgcccgaggtgaacggcgcgctggtcggtggcgccagcctg
aaggcggccgacttccttgccatcgccgccggctgcccctag

DBGET integrated database retrieval system