KEGG   Rhodopseudomonas palustris BisA53: RPE_2678Help
Entry
RPE_2678          CDS       T00400                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPE_2678
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RPE_2678
Enzymes [BR:rpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RPE_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3001382..3002362
Genome map
AA seq 326 aa AA seqDB search
MTPPGPTVSIDAKRVALLGVPVDLGASQRGTLMGPAALRTAGLVPMLQSLDLAVEDHGDV
AVAALPELDDPPPANARQYREIQRWTRAVSAAAYRLAGSGAIPLFLGGDHTLSMGSVNGV
ARYWKERGRELFLLWLDAHADYNTPETTVTGNMHGMSAAFLCGEPGLDRLLGDEPRASLP
PQRLELFGVRAIDALERQLVQQRKVGIADMRRIDEFGVSVLMRDIIARVRACDGVLHVSF
DVDFLDPDLAPGVGTMVPGGATYREAHLVMEMLHDAGLVVAADVVELNPFLDERGRTART
AVELIGSLFGQQITERSATVTFNPDE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccacccggtccgacggtttcgatcgatgcgaagcgggtggcactgctcggcgtg
ccggtcgatctcggtgcctcgcagcgcggcacactgatggggccggcggcgctgcggacc
gcggggctggtgccgatgctgcaatcgctcgaccttgcggtcgaggaccacggcgacgtt
gcggtggccgcccttcctgagctcgacgatccgccacccgccaacgcccgacaatatcgc
gaaatccagcgctggacccgggcggtcagcgccgcggcctaccggctggccggctcgggc
gcgatcccgctgtttctcggcggtgatcacaccttgtcgatggggtcggtgaatggcgtc
gcgcggtattggaaggagcggggccgggagttgttcctgctctggctcgatgcccatgcc
gactacaatacccccgagaccacggtcaccggcaatatgcacggcatgtcggcggcattt
ctgtgcggcgagcccgggctcgaccgtctgcttggtgacgagccgcgtgcctcgctgccg
ccgcagcgccttgaactgttcggggtccgcgctatcgatgctctggagcggcagttggtg
cagcagcgcaaggtcggcatcgccgacatgcggcggatcgacgaattcggcgtcagcgtg
ctgatgcgggatatcatcgcgcgggtgcgggcctgcgacggcgtgctgcacgtgtcgttc
gacgtcgatttcctcgatccggatctggccccgggggtcggcaccatggtgccgggcggc
gccacctatcgtgaggcgcatctggtgatggaaatgttgcacgatgctgggctggtggtc
gcagccgacgtggtcgagctcaacccgttcctcgacgagcgcggccgcaccgcgcgcacc
gccgtcgaactgatcggcagcctgttcggccaacagatcaccgagcggtcagcaactgtt
accttcaatcccgacgagtga

DBGET integrated database retrieval system